BioLiP

>protein
GDIGLIIAVKRLAAAKTRLAPVFSAQTRENVVLAMLVDTLTAAAGVGSLRSITVITPDEAAAAAAAGLGADVLADPTPPD
PLNTAITAAERVVAEGASNIVVLQGDLPALQTQELAEAISAARHHRRSFVADGTGTAVLCAFGTALHPRFGPDSSARHRR
GAVELTGAWPGLRCDVDTPADLTAARQLGVGPATARAVAH

The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6bwh:A	207	206	1.0000	0.9662	0.9709	5.94e-133	6bwh:B, 6bwh:C
2	7p97:AAA	203	200	0.3050	0.3005	0.3050	2.19e-08	7p97:BBB
3	4pfh:A	298	62	0.1000	0.0671	0.3226	4.8	5j8l:A, 5j8l:B, 5j8l:C, 5j8l:D, 2ou4:A, 2ou4:B, 2ou4:C, 2ou4:D, 4pfh:B, 4pgl:A, 4pgl:B, 4pgl:C, 4pgl:D, 4q7i:A, 4q7i:B, 2qul:A, 2qul:B, 2qul:C, 2qul:D, 2qum:A, 2qum:B, 2qum:C, 2qum:D, 2qun:A, 2qun:B, 2qun:C, 2qun:D, 4xsl:A, 4xsl:B, 4xsl:C, 4xsl:D, 4xsm:A, 4xsm:B, 4xsm:C, 4xsm:D, 4ytq:A, 4ytq:B, 4ytq:C, 4ytq:D, 4ytr:A, 4ytr:B, 4ytr:C, 4ytr:D, 4yts:A, 4yts:B, 4yts:C, 4yts:D, 4ytt:A, 4ytt:B, 4ytt:C, 4ytt:D, 4ytu:A, 4ytu:B, 4ytu:C, 4ytu:D
4	4qoq:A	481	36	0.0600	0.0249	0.3333	6.7	4qol:A, 4qol:B, 4qol:C, 4qol:D, 4qom:A, 4qom:B, 4qom:C, 4qom:D, 4qon:A, 4qon:B, 4qon:C, 4qon:D, 4qoo:A, 4qoo:B, 4qoo:C, 4qoo:D, 4qop:A, 4qop:B, 4qop:C, 4qop:D, 4qoq:B, 4qoq:C, 4qoq:D, 4qor:A, 4qor:B, 4qor:C, 4qor:D
5	6vdc:A	497	57	0.0950	0.0382	0.3333	8.3
6	1k7w:D	450	49	0.0850	0.0378	0.3469	8.6	1dcn:D, 1hy0:A, 1hy0:B, 1k7w:A, 1k7w:C, 1k7w:B, 1tjw:A, 1tjw:B, 1tjw:C, 1tjw:D
7	6vdd:A	567	57	0.0950	0.0335	0.3333	8.7	6vdd:D

[Back]