GDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANA
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fvl:A | 83 | 78 | 1.0000 | 0.9398 | 1.0000 | 3.41e-52 | 5fvk:A, 5fvk:B, 5fvl:B, 4niq:A, 4niq:B |
2 | 4u7y:A | 83 | 76 | 0.4487 | 0.4217 | 0.4605 | 2.19e-13 | 2jqk:A |
3 | 2k3w:A | 73 | 69 | 0.4231 | 0.4521 | 0.4783 | 3.00e-13 | 2jq9:A |
4 | 2ymb:D | 231 | 74 | 0.2949 | 0.0996 | 0.3108 | 3.82e-09 | 4a5x:A, 4a5x:B, 2ymb:C |
5 | 1chm:A | 401 | 33 | 0.1538 | 0.0299 | 0.3636 | 1.8 | 1chm:B |
6 | 6gne:B | 494 | 28 | 0.1667 | 0.0263 | 0.4643 | 3.7 | 6gne:A |
7 | 6enz:A | 487 | 42 | 0.1667 | 0.0267 | 0.3095 | 4.1 | 6enz:B |
8 | 6dql:A | 227 | 50 | 0.1923 | 0.0661 | 0.3000 | 5.6 | |
9 | 4v7e:BY | 138 | 63 | 0.2436 | 0.1377 | 0.3016 | 5.6 | 8ip8:ba, 8ip9:ba, 8ipa:ba, 8ipb:ba, 8jiw:BY, 4v3p:SU |
10 | 6p2l:A | 685 | 59 | 0.2308 | 0.0263 | 0.3051 | 7.1 | |
11 | 5mul:A | 378 | 49 | 0.2051 | 0.0423 | 0.3265 | 7.8 |