GAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQL
QAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTP
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6ahr:G | 131 | 131 | 1.0000 | 1.0000 | 1.0000 | 8.83e-95 | 6ahu:G, 6lt7:A, 6lt7:D |
| 2 | 4lhd:A | 952 | 95 | 0.1908 | 0.0263 | 0.2632 | 6.6 | 4lhc:A, 4lhc:B, 4lhd:B |
| 3 | 4by9:F | 366 | 42 | 0.1221 | 0.0437 | 0.3810 | 10.0 | 4by9:I, 4by9:C, 4by9:L, 3nmu:A, 3nmu:B, 3nvi:A, 3nvi:C, 3nvk:A, 3nvk:F |
umich.edu