GASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIM
The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1t6o:A | 49 | 49 | 1.0000 | 1.0000 | 1.0000 | 1.14e-29 | |
2 | 3e3k:B | 500 | 34 | 0.3061 | 0.0300 | 0.4412 | 0.81 | 7a0c:A, 7a0c:B, 4dcx:A, 4dcx:B, 4dcy:A, 4dcy:B, 3dp8:A, 3dp8:B, 3dp8:C, 3e3k:A, 3e3k:C, 4i8c:A, 4i8c:B, 4i8c:C, 4i9d:A, 4i9d:B, 5l8d:A, 5l8d:B, 3mvw:A, 3mvw:B, 3mvx:A, 3mvx:B, 3mvy:A, 3mvy:B, 3mvz:A, 3mvz:B, 3mw0:A, 3mw0:B, 5mwu:A, 5mwu:B, 3mz9:A, 3mz9:B, 3mzb:A, 3mzb:B, 2noo:A, 5on0:A, 5on0:B, 5on1:A, 5on1:B, 5on4:A, 5on4:B, 5on5:A, 5on5:B, 5on8:A, 5on8:B, 5on9:A, 5on9:B, 6r4q:A, 6r4q:B, 8spm:A, 1zlq:A, 1zlq:B |
3 | 6tvo:A | 1011 | 23 | 0.2041 | 0.0099 | 0.4348 | 2.0 | 2l1l:B |
4 | 5kk5:A | 1201 | 35 | 0.2245 | 0.0092 | 0.3143 | 8.1 |