GASGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCD
The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6slr:B | 81 | 81 | 1.0000 | 0.9877 | 0.9877 | 4.82e-54 | 6slr:C, 4v2o:B, 4v2o:C |
| 2 | 7k5b:B | 4524 | 49 | 0.1500 | 0.0027 | 0.2449 | 1.1 | 8bx8:B, 7k58:B, 7kek:B |
| 3 | 1x8d:A | 104 | 32 | 0.1625 | 0.1250 | 0.4062 | 1.9 | 1x8d:B, 1x8d:C, 1x8d:D |
| 4 | 3mx6:B | 260 | 76 | 0.2125 | 0.0654 | 0.2237 | 1.9 | 3mr1:A, 3mr1:B, 3mr1:C, 3mr1:D, 3mx6:A |
| 5 | 8h68:A | 624 | 43 | 0.1500 | 0.0192 | 0.2791 | 2.1 | 8hb2:A, 8hb2:B, 8hb2:C, 8hb2:D, 8hbb:A, 8hbb:B, 8hbb:C, 8hbb:D |
| 6 | 4e84:A | 313 | 23 | 0.1125 | 0.0288 | 0.3913 | 3.4 | 4e84:B, 4e8w:A, 4e8w:B, 4e8y:A, 4e8y:B, 4e8z:A, 4e8z:B |
| 7 | 1zjc:A | 413 | 22 | 0.1000 | 0.0194 | 0.3636 | 5.0 | |
| 8 | 4fb3:A | 115 | 68 | 0.2125 | 0.1478 | 0.2500 | 5.5 | 4fb3:B, 4fb3:E |
| 9 | 8sgh:A | 844 | 22 | 0.1250 | 0.0118 | 0.4545 | 5.7 | 7cyl:A, 4fdd:A, 4fq3:A, 2h4m:A, 5j3v:A, 5j3v:B, 4jlq:A, 4oo6:A, 2ot8:A, 5tqc:A, 7vpw:A, 5yvi:A, 2z5k:A, 2z5m:A, 2z5n:A, 2z5o:A |
| 10 | 5yvg:A | 830 | 22 | 0.1250 | 0.0120 | 0.4545 | 5.9 | 2h4m:B, 2ot8:B, 5yvh:A |
| 11 | 5yvg:B | 764 | 22 | 0.1250 | 0.0131 | 0.4545 | 6.2 | |
| 12 | 3g5a:B | 305 | 22 | 0.1250 | 0.0328 | 0.4545 | 6.4 | 3fwk:A, 3g59:A, 3g5a:A, 3g5a:C, 3g5a:D, 3g5a:E, 3g5a:F, 3g6k:A, 3g6k:B, 3g6k:C, 3g6k:D, 3g6k:E, 3g6k:F, 4kkv:A |
umich.edu