GARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYE
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3abk:G | 84 | 72 | 1.0000 | 0.8571 | 1.0000 | 7.06e-50 | 3abk:T, 3ag1:G, 3ag1:T, 3ag2:G, 3ag2:T, 3ag3:T, 3ag4:T, 5b3s:G, 7coh:G, 7coh:T, 2dyr:G, 2dyr:T, 2dys:G, 2dys:T, 2eij:G, 2eij:T, 2eik:G, 2eik:T, 2eil:G, 2eil:T, 2eim:T, 2ein:G, 2ein:T, 7ev7:G, 7ev7:T, 8gbt:G, 8gcq:G, 8h8s:T, 8h8s:G, 8ijn:T, 6jy3:G, 6jy4:G, 6nkn:G, 6nkn:T, 7thu:G, 7tie:G, 7tih:G, 7vuw:G, 7vuw:T, 7vvr:G, 5wau:g, 3x2q:T, 7y44:G, 7y44:T, 7ypy:G, 7ypy:T |
| 2 | 6fhq:A | 58 | 17 | 0.0972 | 0.1207 | 0.4118 | 4.0 | 6fhq:B, 6fi1:A, 6fi1:B, 4qf3:A, 4qf3:B |
| 3 | 4gd3:A | 179 | 53 | 0.2222 | 0.0894 | 0.3019 | 4.1 | 6g94:A, 6g94:B, 4gd3:B |
umich.edu