GAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQ
VFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRR
KKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2y8w:A | 215 | 213 | 1.0000 | 0.9907 | 1.0000 | 5.60e-149 | 3qrp:A, 3qrq:A, 3qrr:A, 2y8y:A, 2y9h:A, 2y9h:C, 2y9h:E, 2y9h:G, 2y9h:I |
2 | 2y9h:M | 193 | 213 | 0.9061 | 1.0000 | 0.9061 | 5.55e-127 | 2y9h:K, 2y9h:O |
3 | 8yha:B | 268 | 266 | 0.3850 | 0.3060 | 0.3083 | 3.45e-17 | 8yb6:B |
4 | 5cd4:A | 199 | 222 | 0.3192 | 0.3417 | 0.3063 | 5.58e-17 | 5cd4:M, 4tvx:A, 4tvx:M, 4u7u:D, 4u7u:P |
5 | 6c66:O | 212 | 220 | 0.3099 | 0.3113 | 0.3000 | 2.78e-14 | 5u0a:A |
6 | 5h9f:K | 159 | 211 | 0.3005 | 0.4025 | 0.3033 | 4.96e-14 | 5h9e:K |
7 | 4qyz:K | 152 | 210 | 0.2723 | 0.3816 | 0.2762 | 1.10e-09 | |
8 | 5u07:A | 190 | 217 | 0.2958 | 0.3316 | 0.2903 | 7.51e-07 | |
9 | 2okk:A | 483 | 76 | 0.1080 | 0.0476 | 0.3026 | 0.071 | |
10 | 8gz0:B | 160 | 36 | 0.0704 | 0.0938 | 0.4167 | 1.3 | 8gz0:A, 7wrk:A, 7wwn:A, 7wwo:A, 7wwo:B |
11 | 6jdq:A | 1069 | 40 | 0.0516 | 0.0103 | 0.2750 | 3.8 | 6je4:A, 6je4:E, 6je4:K, 6je9:A |
12 | 6jdv:A | 1036 | 40 | 0.0516 | 0.0106 | 0.2750 | 3.8 | 6kc8:A |
13 | 6kc7:A | 963 | 40 | 0.0516 | 0.0114 | 0.2750 | 4.1 | |
14 | 6je4:O | 1049 | 40 | 0.0516 | 0.0105 | 0.2750 | 4.1 | 8hj4:A, 8ja0:A, 6je9:C |
15 | 6jx3:B | 85 | 59 | 0.0892 | 0.2235 | 0.3220 | 7.7 | |
16 | 6fdz:U | 265 | 61 | 0.0798 | 0.0642 | 0.2787 | 7.7 | 6fdy:U |