GAMLKDKSLGEGIKDLVIDLQKKVPMKVVHEIQDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRI
The query sequence (length=133) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4gt8:A |
133 |
133 |
1.0000 |
1.0000 |
1.0000 |
3.61e-95 |
|
2 |
8sbm:B |
126 |
98 |
0.2632 |
0.2778 |
0.3571 |
1.81e-12 |
8sbm:A, 3zxo:A, 3zxo:B |
3 |
7ssj:A |
219 |
104 |
0.1880 |
0.1142 |
0.2404 |
0.005 |
3ehf:A, 3ehf:D, 3ehg:A, 3ehh:A, 3ehh:B, 3ehj:A, 3ehj:B, 3gie:A, 3gie:B, 3gif:A, 3gig:A, 3gig:B, 5iuj:A, 5iuj:B, 5iuj:D, 5iuj:E, 5iuk:A, 5iuk:B, 5iuk:D, 5iuk:E, 5iul:A, 5iul:B, 5iul:D, 5iul:E, 5ium:A, 5ium:B, 7ssi:A, 7ssi:B, 7ssi:D, 7ssi:E, 7ssj:C, 7ssj:D |
4 |
8g3b:E |
334 |
90 |
0.1353 |
0.0539 |
0.2000 |
1.1 |
8g3f:E |
5 |
8f5f:A |
326 |
118 |
0.2105 |
0.0859 |
0.2373 |
3.5 |
4dzy:A, 4e00:A, 4e01:A, 4e02:A, 8egd:A, 8egf:A, 8egq:A, 8egu:A, 8f4q:A, 8f5f:B, 8f5j:A, 8f5s:A, 8f5s:B, 1gjv:A, 1gkz:A, 4h7q:A, 4h81:A, 4h85:A, 3tz0:A, 3tz2:A, 3tz4:A, 3tz5:A, 3vad:A |
6 |
6bxj:A |
619 |
25 |
0.0902 |
0.0194 |
0.4800 |
3.9 |
3bn3:A, 3bqm:B, 3bqm:C, 3bqn:B, 3bqn:C, 6bxb:A, 6bxb:B, 6bxf:A, 6bxf:B, 6ckb:A, 6ckb:B, 1cqp:A, 1cqp:B, 3e2m:A, 3e2m:B, 3eob:I, 3eob:J, 3f74:C, 3f78:A, 3f78:B, 3f78:C, 3hi6:A, 3hi6:B, 2ica:A, 4ixd:A, 7kc3:C, 7kc5:A, 7kc5:C, 7kc6:C, 7kc6:A, 1lfa:A, 1lfa:B, 3m6f:A, 1mjn:A, 1mq8:B, 1mq8:D, 1mq9:A, 2o7n:A, 1rd4:A, 1rd4:B, 1rd4:C, 1rd4:D, 1t0p:A, 3tcx:B, 3tcx:D, 3tcx:F, 3tcx:H, 3tcx:J, 3tcx:L, 3tcx:N, 3tcx:P, 3tcx:R, 3tcx:T, 3tcx:V, 3tcx:X, 3tcx:Z, 3tcx:b, 1xdd:A, 1xdd:B, 1xdg:A, 1xdg:B, 1xuo:A, 1xuo:B, 1zoo:A, 1zoo:B, 1zop:A, 1zop:B |
7 |
4ew2:A |
205 |
30 |
0.0977 |
0.0634 |
0.4333 |
4.6 |
4ew3:A, 8fdx:A, 8fdy:A, 8fdz:A, 8fe0:A, 8fjv:A, 8fjw:A, 8fjx:A, 8fjy:A, 5j9f:A, 7jg0:A, 7jg3:A, 7jg4:A, 1men:A, 1men:B, 1men:C, 1njs:A, 1njs:B, 1rbm:A, 1rbm:B, 1rbq:A, 1rbq:B, 1rbq:C, 1rbq:D, 1rby:A, 1rby:B, 1rby:C, 1rby:D, 1rbz:A, 1rbz:B, 1rc0:A, 1rc0:B, 1rc1:A, 1rc1:B, 1zly:A, 4zyt:A, 4zyu:A, 4zyv:A, 4zyw:A, 4zyx:A, 4zyy:A, 4zyz:A, 4zz0:A, 4zz1:A, 4zz2:A, 4zz3:A |
8 |
7jps:E |
386 |
32 |
0.0902 |
0.0311 |
0.3750 |
4.7 |
7cte:E, 7ctf:E, 7ctg:E |
9 |
1gdi:A |
153 |
33 |
0.0977 |
0.0850 |
0.3939 |
5.4 |
1gdj:A, 1gdk:A, 1gdl:A, 2gdm:A, 1lh1:A, 1lh2:A, 1lh3:A, 1lh5:A, 1lh6:A, 1lh7:A, 2lh1:A, 2lh2:A, 2lh3:A, 2lh5:A, 2lh6:A, 2lh7:A |
10 |
7jpp:E |
406 |
71 |
0.1654 |
0.0542 |
0.3099 |
7.1 |
7jpo:E, 7jpq:E, 7jpr:E, 5uj7:E, 5uj7:F |
11 |
6lzj:A |
245 |
39 |
0.1128 |
0.0612 |
0.3846 |
8.8 |
6lzi:A |
12 |
7obq:u |
441 |
61 |
0.1429 |
0.0431 |
0.3115 |
9.3 |
6frk:u, 3jaj:6, 3jan:6, 5m73:C, 5m73:G, 7nfx:u, 7obr:u, 4p3e:C, 7qwq:v, 6r6g:AI, 4ue5:C |
13 |
1ijt:A |
128 |
23 |
0.0677 |
0.0703 |
0.3913 |
9.5 |
|
14 |
2d3m:A |
405 |
87 |
0.1579 |
0.0519 |
0.2414 |
9.7 |
2d3m:B, 2d52:A, 2d52:B |