GAMALIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAA
NTKSAANLKVKEL
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1waa:C | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 4.62e-65 | 1waa:A, 1waa:B, 1waa:D, 1waa:E, 1waa:F |
2 | 5jdj:B | 91 | 90 | 0.3118 | 0.3187 | 0.3222 | 1.19e-08 | 5jdj:E, 5jdj:I, 5jdj:L, 4qeg:A |
3 | 4zgf:A | 141 | 72 | 0.2043 | 0.1348 | 0.2639 | 2.9 | |
4 | 5koi:A | 271 | 41 | 0.1183 | 0.0406 | 0.2683 | 2.9 | 5koi:B, 5koi:C, 5koi:D, 5koi:E, 5koi:F, 5koi:G, 5koi:H |
5 | 1i1a:C | 205 | 13 | 0.0753 | 0.0341 | 0.5385 | 4.5 | 1i1c:A |
6 | 6bbx:A | 121 | 21 | 0.0968 | 0.0744 | 0.4286 | 6.4 | 6bbx:B, 5ujp:A, 5ujp:B, 5umx:A, 5umx:B, 5umy:A, 5umy:B, 5w27:A, 5w27:B |
7 | 9b4h:A | 1908 | 44 | 0.1290 | 0.0063 | 0.2727 | 6.9 | 9b4h:B, 8wa2:A, 8wa2:D, 8wa2:F, 8wa2:B, 8wa2:C, 8wa2:E |
8 | 3lst:A | 333 | 41 | 0.1720 | 0.0480 | 0.3902 | 8.3 | 3lst:B |
9 | 5xbx:A | 179 | 23 | 0.0860 | 0.0447 | 0.3478 | 8.6 | 5xc4:A, 5xc8:A, 5xc9:A, 5xca:A |