BioLiP

>protein
GAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS

The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3zpv:1	62	62	1.0000	1.0000	1.0000	4.79e-42	3zpv:3, 3zpv:5, 3zpv:7, 3zpv:9, 3zpv:A, 3zpv:C, 3zpv:E, 3zpv:G, 3zpv:I, 3zpv:K, 3zpv:M, 3zpv:O, 3zpv:Q, 3zpv:S, 3zpv:U, 3zpv:W, 3zpv:Y
2	2vp7:A	66	58	0.4677	0.4394	0.5000	1.61e-19	2dx8:A, 2dx8:B, 2vpb:A, 2vpd:A, 2vpd:C, 2vpe:C, 2vpe:A, 2vpg:A, 2vpg:C, 2yyr:A, 2yyr:B
3	2xb1:C	97	57	0.4516	0.2887	0.4912	5.51e-19	4up0:A, 4up5:A, 2xb1:A
4	5wlf:A	60	46	0.3065	0.3167	0.4130	0.008	5wle:A
5	5c11:A	52	30	0.1774	0.2115	0.3667	0.015	3gl6:A, 2kgg:A, 2kgi:A
6	2ma5:A	61	46	0.2419	0.2459	0.3261	0.034
7	5z8l:A	204	44	0.2742	0.0833	0.3864	0.58	5z8n:A, 5z8n:B, 5z8n:C
8	1wem:A	76	32	0.1774	0.1447	0.3438	0.63	4l7x:A, 2m3h:A
9	7kua:A	149	19	0.1613	0.0671	0.5263	2.6
10	1x4i:A	70	32	0.1935	0.1714	0.3750	4.3	7zmx:A, 7zmx:B
11	5y20:A	52	42	0.2097	0.2500	0.3095	6.5
12	7ok0:P	47	45	0.1613	0.2128	0.2222	6.7	7oq4:P, 7oqy:P
13	2i7t:A	404	13	0.1129	0.0173	0.5385	8.9
14	2i7v:A	433	13	0.1129	0.0162	0.5385	8.9	8t1q:A, 8t1r:A
15	6v4x:H	499	13	0.1129	0.0140	0.5385	9.0	6m8q:A, 6m8q:B
16	1we9:A	64	42	0.2258	0.2188	0.3333	9.8

[Back]