GAHMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFD
VVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPQLALWKGDTSKANLYVDDVYLVEV
The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zew:B | 147 | 147 | 0.9932 | 0.9932 | 0.9932 | 4.62e-107 | 3oea:A, 3oea:B, 3oeb:A, 2zew:A, 2zex:A, 2zex:B, 2zey:B, 2zey:A |
2 | 2zez:C | 143 | 141 | 0.5986 | 0.6154 | 0.6241 | 4.65e-62 | 2zez:A, 2zez:B, 2zez:D |
3 | 5mab:A | 259 | 33 | 0.0748 | 0.0425 | 0.3333 | 2.2 | 5mab:B, 5mab:C, 5mvo:A, 5mvo:B, 5mvo:C |
4 | 5kzw:A | 850 | 33 | 0.0816 | 0.0141 | 0.3636 | 2.2 | 8cb1:A, 8cb6:A, 5kzx:A, 5nn4:A, 5nn5:A, 5nn6:A, 5nn8:A, 7p2z:AaA, 7p32:AAA |
5 | 7ea4:A | 762 | 71 | 0.1361 | 0.0262 | 0.2817 | 3.6 | 7ea4:B, 7eby:A, 7eby:B, 7eby:C, 7eby:D, 7eby:E, 7eby:F |
6 | 5y7p:A | 327 | 83 | 0.1020 | 0.0459 | 0.1807 | 4.9 | 8bls:A, 8bls:B, 8bls:C, 8bls:D, 8bls:E, 8bls:F, 8bls:G, 8bls:H, 8blt:A, 8blt:B, 8blt:C, 8blt:D, 8blt:E, 8blt:F, 8blt:G, 8blt:H, 5y7p:F |
7 | 4x30:A | 372 | 35 | 0.1020 | 0.0403 | 0.4286 | 6.9 | 2ceo:A, 2ceo:B, 2riw:A, 2riw:B, 2xn3:A, 2xn3:B, 2xn5:A, 2xn6:A, 2xn6:B, 2xn7:A, 2xn7:B, 4yia:A, 4yia:B |