GAAYHEWKMALFKPADVILDPDTANAILLVSEDQRSVQRAEEPRDLPDNPERFEWHYCVLGCENFTSGRHYWEVEVGDRK
EWHIGVCSKNVERKKGWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDGSHIYT
FPHASFSEPLYPVFRILTLEPTALTICPI
The query sequence (length=189) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6j0k:A | 191 | 189 | 1.0000 | 0.9895 | 1.0000 | 1.70e-143 | 6j0g:A, 6j0g:B, 6j0g:C, 6j0g:D, 6j0k:B |
2 | 8ixv:A | 187 | 187 | 0.8624 | 0.8717 | 0.8717 | 4.50e-123 | 8ize:A, 8izg:A, 6j06:A, 6j06:C, 6j06:B, 8jyc:C, 8jyc:D, 8jye:C, 8jye:D, 4n7u:A, 5zxk:A |
3 | 8jya:B | 191 | 186 | 0.7884 | 0.7801 | 0.8011 | 3.59e-114 | 8hjt:C, 8hjt:D, 8jy9:A, 8jy9:B, 8jyf:B |
4 | 8hjt:A | 197 | 178 | 0.5132 | 0.4924 | 0.5449 | 7.86e-62 | 8hjt:B |
5 | 8igt:A | 208 | 182 | 0.4868 | 0.4423 | 0.5055 | 6.33e-56 | 8jyc:A, 8jyc:B, 8jye:A, 8jye:B |
6 | 8pd6:A | 181 | 170 | 0.4709 | 0.4917 | 0.5235 | 1.23e-51 | |
7 | 4cg4:C | 376 | 179 | 0.4497 | 0.2261 | 0.4749 | 3.35e-51 | 4cg4:D, 4cg4:E, 4cg4:F |
8 | 7ovx:A | 174 | 165 | 0.3757 | 0.4080 | 0.4303 | 5.16e-38 | 8a5l:A, 8a5m:A, 8a5m:B, 8a8x:A, 8a8x:C, 7ow2:A, 7ow2:B, 7ow2:C, 7ow2:D, 8r5b:A, 8r5b:B, 8r5c:A, 7w0q:A, 7w0s:B, 7w0s:C, 7w0s:E, 7w0t:F, 7w0t:B, 7w0t:C, 7x6y:A, 7x6z:A, 7x70:A |
9 | 7xyz:B | 456 | 169 | 0.2857 | 0.1184 | 0.3195 | 1.58e-23 | 7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D |
10 | 7xt2:B | 388 | 168 | 0.2698 | 0.1314 | 0.3036 | 4.64e-23 | 7xt2:A |
11 | 4b3n:A | 557 | 163 | 0.2963 | 0.1005 | 0.3436 | 8.07e-23 | 4b3n:B |
12 | 3oix:A | 310 | 87 | 0.1270 | 0.0774 | 0.2759 | 0.14 | 3oix:B, 3oix:C, 3oix:D |
13 | 2ihs:A | 203 | 182 | 0.2328 | 0.2167 | 0.2418 | 0.46 | 2ihs:B |
14 | 5ul4:A | 729 | 67 | 0.0952 | 0.0247 | 0.2687 | 1.1 | 5ul3:A |
15 | 2bh2:A | 418 | 52 | 0.1164 | 0.0526 | 0.4231 | 1.8 | 2bh2:B, 1uwv:A |
16 | 8gy2:A | 723 | 28 | 0.0635 | 0.0166 | 0.4286 | 2.8 | |
17 | 4gw9:A | 628 | 29 | 0.0635 | 0.0191 | 0.4138 | 5.6 | 4gw9:B, 4gw9:C, 4gw9:D, 5oy5:A, 5vik:A, 5viq:A, 5viv:A, 4xtq:A |
18 | 4v5k:AY | 97 | 21 | 0.0476 | 0.0928 | 0.4286 | 5.8 | 4udm:B |
19 | 5hiw:A | 391 | 39 | 0.0741 | 0.0358 | 0.3590 | 8.6 | |
20 | 4iil:A | 314 | 50 | 0.0741 | 0.0446 | 0.2800 | 9.3 | |
21 | 8pr4:Y | 375 | 32 | 0.0688 | 0.0347 | 0.4062 | 9.5 |