FWQAEHKVYPPSKIHPGVHKGYIRTGVVHNLMRLLAAAAAAAWAPVTALASFATWRYRAEVAEWLDNLSNVDYPKWLAER
EIAIRRVETEIFWRIEGHAQQRSQVASGQGRAMLNKAAKASYEESEASRLHGAGVSDLLK
The query sequence (length=140) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8iuf:B5 | 140 | 140 | 1.0000 | 1.0000 | 1.0000 | 6.95e-101 | 8j9h:B5, 8j9i:B5, 8j9j:B5 |
| 2 | 7wss:A | 533 | 39 | 0.0857 | 0.0225 | 0.3077 | 4.9 | 8jt1:A, 8jt1:B, 7wss:B, 7xeb:A, 7xeb:B |
| 3 | 7nhk:0 | 495 | 22 | 0.0571 | 0.0162 | 0.3636 | 8.8 |
umich.edu