BioLiP

>protein
FVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQALLDE
DDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFV
NPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHR
VIFLHANAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYW
RGIHKLPERWEKCVASDGKYFE

The query sequence (length=342) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4u7b:A	342	342	1.0000	1.0000	1.0000	0.0	3hos:A, 3hos:B, 3hot:A, 3hot:B, 5hoo:A, 5hoo:B, 4r79:A, 4r79:B, 4u7b:B, 4u7b:G
2	2f7t:A	204	227	0.5936	0.9951	0.8943	6.87e-149	4mda:A, 4mdb:A
3	3f2k:A	197	223	0.2427	0.4213	0.3722	5.96e-46	3f2k:B
4	7s03:A	108	104	0.0877	0.2778	0.2885	3.37e-14
5	1tiq:A	173	87	0.0673	0.1329	0.2644	1.8	1tiq:B
6	7cuh:A	305	79	0.0526	0.0590	0.2278	1.9	4hid:A, 4hik:A, 4him:A, 4hio:A, 4hj5:A, 4hj7:A, 4hj8:A, 4hj9:A, 4hja:A, 5usb:A, 5usn:A, 5uso:A
7	4etp:A	379	85	0.0789	0.0712	0.3176	4.0	1f9t:A, 1f9u:A, 1f9v:A, 3kar:A
8	7v3x:T	415	75	0.0585	0.0482	0.2667	4.8
9	2d3k:B	118	36	0.0322	0.0932	0.3056	4.8
10	4rl6:A	414	59	0.0585	0.0483	0.3390	6.0	4rl6:B
11	6c2c:A	299	56	0.0556	0.0635	0.3393	7.7	6c2c:B, 5hif:A, 5hif:B

[Back]