BioLiP

>protein
FTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTGSDAKFVLHAKQNGI
IRRGHNWVFKADSYESMMSWFDNLKILTS

The query sequence (length=109) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4a6f:B	110	112	0.9541	0.9455	0.9286	2.58e-70	4a6f:A, 4a6h:A, 4a6h:C, 4a6h:B, 4a6h:D, 4a6k:A, 4a6k:C, 4a6k:B, 4a6k:D
2	9c1w:A	388	111	0.2477	0.0696	0.2432	0.018	8q61:A
3	6hhg:A	386	63	0.1376	0.0389	0.2381	0.090	4ejn:A, 6hhf:A, 6hhh:A, 7nh4:A, 7nh5:A, 3o96:A, 6s9x:A
4	6bbp:A	520	55	0.1193	0.0250	0.2364	1.5	2a5d:A, 2a5f:A, 2a5g:A, 6bbq:A, 1e0s:A, 1fgy:A, 1fhw:A, 1fhw:B, 1fhx:A, 1fhx:B, 4fme:C, 4fme:F, 2j5x:A, 2j5x:B, 4kax:A, 4kax:B, 3n5c:A, 3n5c:B, 3pcr:B, 2r09:A, 2r09:B, 2r0d:A, 2r0d:B, 3vhx:A, 3vhx:C, 3vhx:E, 3vhx:G, 2w83:A, 2w83:B, 2w83:E, 7xrd:A, 7xrd:B, 7xrd:C, 7xrd:D
5	6u3e:A	397	55	0.1193	0.0327	0.2364	1.7	6u3e:B, 6u3g:A, 6u3g:B
6	6s9w:A	411	66	0.1376	0.0365	0.2273	1.9	6buu:A, 6buu:B, 6ccy:A, 3cqu:A, 3cqw:A, 4ekk:A, 4ekk:B, 4ekl:A, 4gv1:A, 1h10:A, 6hhi:A, 6hhj:A, 3mv5:A, 3mvh:A, 6npz:A, 6npz:B, 3ocb:A, 3ocb:B, 3ow4:A, 3ow4:B, 3qkk:A, 3qkl:A, 3qkm:A, 1unq:A, 2uvm:A, 8uvy:A, 8uw2:A, 8uw7:A, 8uw9:A, 2uzs:A
7	6rb7:A	305	67	0.1927	0.0689	0.3134	3.1	6rb7:B, 6rb7:E, 6rb7:F, 6rd1:A, 6rd1:B
8	5u77:A	117	47	0.1468	0.1368	0.3404	3.6
9	3aj4:A	112	23	0.0917	0.0893	0.4348	7.6
10	4p9c:A	136	17	0.0826	0.0662	0.5294	8.0	4p9c:B, 4p9c:C, 4p9c:D, 4p9c:E, 4p9c:F, 4p9c:G, 4p9c:H, 4p9c:I, 4p9c:J, 4p9c:K, 4p9c:L, 4p9d:A, 4p9d:B, 4p9d:C, 4p9d:D, 4p9d:E, 4p9d:F, 4p9e:A
11	6qwo:B	253	30	0.1009	0.0435	0.3667	8.2	6qwo:A
12	6yxy:EE	433	33	0.1193	0.0300	0.3939	9.9	7aoi:XO, 6yxx:EE

[Back]