FSRRRIAYPFYPFKKLGRQHPKKHDTNLKTAMRQFLGPKNYKGEYVMNKYFTVPTNHVPNYIKPDLERGQSLEHPVTKKP
LQLRYDGTLGPPPVENKRLQNIFKDRLLQPFPSNPHCKTNYVLSPQLKQSIFEEITVEGLSAQQVSQKYGLKIPRVEAIV
KLVSVENSWNRRNRVSSDLKTMDETLYRMFPVFDSNTKVIYGELVEGERSQYKFTNAKVGKVGYRYGSGNRDNKKDRRIG
FNKLGQMVYI
The query sequence (length=250) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8d8k:6 | 251 | 251 | 1.0000 | 0.9960 | 0.9960 | 0.0 | 8d8j:6 |
2 | 8om2:6 | 319 | 197 | 0.7800 | 0.6113 | 0.9898 | 5.50e-145 | 8d8l:6, 5mrc:66, 5mre:66, 5mrf:66, 8om3:6, 8om4:6 |
3 | 8om2:6 | 319 | 57 | 0.2200 | 0.1724 | 0.9649 | 8.98e-31 | 8d8l:6, 5mrc:66, 5mre:66, 5mrf:66, 8om3:6, 8om4:6 |
4 | 6yw5:66 | 283 | 66 | 0.1000 | 0.0883 | 0.3788 | 5.49e-09 | 6ywe:66, 6ywx:66, 6ywy:66 |
5 | 3bga:A | 1003 | 134 | 0.1480 | 0.0369 | 0.2761 | 0.054 | 3bga:B |
6 | 7nwf:A | 432 | 99 | 0.1240 | 0.0718 | 0.3131 | 0.26 | 6t8k:A, 6t8k:B, 6t8l:A, 6tcw:A |
7 | 6tcv:B | 397 | 95 | 0.1240 | 0.0781 | 0.3263 | 0.31 | |
8 | 2e2z:A | 100 | 43 | 0.0720 | 0.1800 | 0.4186 | 0.38 | |
9 | 8buu:9 | 573 | 75 | 0.0840 | 0.0366 | 0.2800 | 1.6 | |
10 | 5fg3:A | 598 | 117 | 0.1120 | 0.0468 | 0.2393 | 5.3 | 5yt0:A |
11 | 4p92:A | 233 | 69 | 0.0800 | 0.0858 | 0.2899 | 7.2 | |
12 | 7nac:5 | 141 | 103 | 0.1000 | 0.1773 | 0.2427 | 9.2 | 7nad:5 |