FSRRRIAYPFYPFKKLGRQHPKKHDTNLKTAMRQFLGPKNYKGEYVMNKYFTVPTNHVPNYIKPDLERGQSLEHPVTKKP
LQLRYDGTLGPPPVENKRLQNIFKDRLLQPFPSNPHCKTNYVLSPQLKQSIFEEITVEGLSAQQVSQKYGLKIPRVEAIV
KLVSVENSWNRRNRVSSDLKTMDETLYRMFPVFDSDNTKVIYGELVEGERSQYKFTNAKVGKVGYRYGSGNRDNKKDRRI
GFNKLGQMVYI
The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8d8k:6 | 251 | 251 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8d8j:6 |
2 | 8om2:6 | 319 | 198 | 0.7809 | 0.6144 | 0.9899 | 1.32e-145 | 8d8l:6, 5mrc:66, 5mre:66, 5mrf:66, 8om3:6, 8om4:6 |
3 | 8om2:6 | 319 | 55 | 0.2191 | 0.1724 | 1.0000 | 1.18e-30 | 8d8l:6, 5mrc:66, 5mre:66, 5mrf:66, 8om3:6, 8om4:6 |
4 | 6yw5:66 | 283 | 66 | 0.0996 | 0.0883 | 0.3788 | 5.77e-09 | 6ywe:66, 6ywx:66, 6ywy:66 |
5 | 3bga:A | 1003 | 135 | 0.1474 | 0.0369 | 0.2741 | 0.23 | 3bga:B |
6 | 7nwf:A | 432 | 99 | 0.1235 | 0.0718 | 0.3131 | 0.27 | 6t8k:A, 6t8k:B, 6t8l:A, 6tcw:A |
7 | 6tcv:B | 397 | 95 | 0.1235 | 0.0781 | 0.3263 | 0.30 | |
8 | 2e2z:A | 100 | 43 | 0.0717 | 0.1800 | 0.4186 | 0.40 | |
9 | 8buu:9 | 573 | 75 | 0.0837 | 0.0366 | 0.2800 | 1.7 | |
10 | 5fg3:A | 598 | 117 | 0.1036 | 0.0435 | 0.2222 | 3.8 | 5yt0:A |
11 | 1c3r:A | 372 | 62 | 0.0837 | 0.0565 | 0.3387 | 6.6 | 1c3r:B, 1c3s:A |