FSRRRIAYPFYPFKKLGRQHPKKHDTNLKTAMRQFLGPKNYKGEYVMNKYFTVPTNHVPNYIKPDLERGQSLEHPVTKKP
LQLRYDGTLGPPPVENKRLQNIFKDRLLQPFPSNPHCKTNYVLSPQLKQSIFEEITVEGLSAQQVSQKYGLKIPRVEAIV
KLVSVENSWNRRNRVSSDLKTMDETLYRMFPVFDSDASFKRENLSEIPVPQKTLASRFLTIAESEPFGPVDAAHVLELEP
AVETLRNLSTNTKVIYGELVEGERSQYKFTNAKVGKVGYRYGSGNRDNKKDRRIGFNKLGQMVYI
The query sequence (length=305) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8om2:6 | 319 | 319 | 1.0000 | 0.9561 | 0.9561 | 0.0 | 8d8l:6, 5mrc:66, 5mre:66, 5mrf:66, 8om3:6, 8om4:6 |
2 | 8d8k:6 | 251 | 305 | 0.7639 | 0.9283 | 0.7639 | 1.28e-158 | 8d8j:6 |
3 | 6yw5:66 | 283 | 143 | 0.1311 | 0.1413 | 0.2797 | 1.60e-10 | 6ywe:66, 6ywx:66, 6ywy:66 |
4 | 7nwf:A | 432 | 99 | 0.1016 | 0.0718 | 0.3131 | 0.26 | 6t8k:A, 6t8k:B, 6t8l:A, 6tcw:A |
5 | 6tcv:B | 397 | 94 | 0.1016 | 0.0781 | 0.3298 | 0.34 | |
6 | 2e2z:A | 100 | 41 | 0.0525 | 0.1600 | 0.3902 | 1.1 | |
7 | 8buu:9 | 573 | 75 | 0.0689 | 0.0366 | 0.2800 | 1.7 | |
8 | 6jem:A | 440 | 40 | 0.0426 | 0.0295 | 0.3250 | 3.0 | 6jem:B, 6jem:C, 6jen:A, 6jen:B, 6jen:C |
9 | 2pw6:A | 244 | 65 | 0.0754 | 0.0943 | 0.3538 | 5.9 | |
10 | 5de0:B | 298 | 56 | 0.0590 | 0.0604 | 0.3214 | 9.7 | 5de0:A, 5de0:C, 5de0:D |