FSKACLKNVFSVLLIFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYPGQAQLLSCKHHYEVIP
PLTSPGQPGDMNCTTQRINYTDPFSNQTVKSALIVQGPREVKKRELVFLQFRLNKSSEDFSAIDYLLFSSFQEFLQSPNR
VGFMQACESAYSSWKFSGGFRTWVKMSLVKTKEEDGREAVEFRQETSVVNYIDQRPAAKKSAQLFFVVFEWKDPFIQKVQ
DIVTANPWNTIALLCGAFLALFKAAEFAKLSIKWMIKIRKRYL
The query sequence (length=283) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8eq4:A | 283 | 283 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8eq4:B, 8eq4:C, 8fbl:A, 8fbl:B, 8fbl:C |
2 | 8h8e:D | 293 | 284 | 0.7420 | 0.7167 | 0.7394 | 9.73e-157 | 8h8e:B, 8h8e:C, 8h8e:E, 8h8e:F |
3 | 4yed:D | 255 | 123 | 0.1166 | 0.1294 | 0.2683 | 0.51 | 4d79:A, 4d79:B, 4d79:C, 4d79:D, 4d7a:A, 4d7a:B, 4d7a:D, 4rdh:A, 4rdh:B, 4rdh:C, 4rdh:D, 4rdi:A, 4rdi:B, 4rdi:C, 4rdi:D, 4yed:A, 4yed:B, 4yed:C |
4 | 5cdl:A | 349 | 71 | 0.0707 | 0.0573 | 0.2817 | 2.6 | 5cdv:A, 5giq:A |
5 | 6nt2:A | 330 | 149 | 0.1378 | 0.1182 | 0.2617 | 6.1 | 6nt2:D, 6nt2:B, 6nt2:C, 1or8:A, 1orh:A, 1ori:A, 3q7e:A |
6 | 2g5g:X | 255 | 33 | 0.0424 | 0.0471 | 0.3636 | 9.3 |