FSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTGPQGWSPRERAALQEELSDVLIYLVAL
AARCRVDLPLAVLSKMDINRRRYP
The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7mu5:A | 110 | 108 | 1.0000 | 0.9455 | 0.9630 | 3.05e-70 | 7mu5:E, 7mu5:B, 7mu5:H, 7mu5:C, 7mu5:D, 7mu5:F, 7mu5:G |
2 | 6sqw:A | 114 | 108 | 0.9038 | 0.8246 | 0.8704 | 7.10e-64 | 2oig:B, 2oig:A, 2oig:D, 6sqw:D, 6sqy:A, 6sqy:D, 6sqz:A, 6sqz:D |
3 | 4qgp:A | 108 | 99 | 0.3365 | 0.3241 | 0.3535 | 4.98e-15 | 4qgp:B |
4 | 2q5z:B | 94 | 76 | 0.2500 | 0.2766 | 0.3421 | 1.99e-04 | 2q5z:A, 2q73:A, 2q73:B, 2q73:C, 2q73:D, 2q9l:A, 2q9l:B, 2q9l:C, 2q9l:D |
5 | 5ie9:C | 95 | 66 | 0.1923 | 0.2105 | 0.3030 | 0.012 | 5ie9:A, 5ie9:B, 5ie9:D |
6 | 7ody:C | 100 | 73 | 0.2212 | 0.2300 | 0.3151 | 0.54 | 7ody:A, 7ody:B, 7ody:D |
7 | 4dl8:A | 224 | 65 | 0.1442 | 0.0670 | 0.2308 | 1.2 | 4dk4:A, 4dk4:B, 4dkb:A, 4dlc:A |
8 | 9f2k:A | 513 | 22 | 0.1058 | 0.0214 | 0.5000 | 1.2 | |
9 | 8u3g:A | 427 | 26 | 0.1058 | 0.0258 | 0.4231 | 3.9 | 8u3h:A |
10 | 4ry8:B | 321 | 31 | 0.1154 | 0.0374 | 0.3871 | 4.2 | 4ry8:A, 4ry8:C, 4ry8:D |
11 | 3frh:A | 241 | 32 | 0.1154 | 0.0498 | 0.3750 | 5.7 | 3b89:A, 3fri:A |
12 | 5euf:B | 416 | 35 | 0.1058 | 0.0264 | 0.3143 | 6.4 | 5euf:A |
13 | 4u08:A | 391 | 38 | 0.1250 | 0.0332 | 0.3421 | 9.7 | 4u08:B |
14 | 1g6u:A | 48 | 31 | 0.1154 | 0.2500 | 0.3871 | 9.8 | 1g6u:B |