FSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGPQGWSPRERAALQEELSDVLIYLVA
LAARCRVDLPLAVLSKMDINRRRYP
The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7mu5:A | 110 | 108 | 1.0000 | 0.9545 | 0.9722 | 3.32e-71 | 7mu5:E, 7mu5:B, 7mu5:H, 7mu5:C, 7mu5:D, 7mu5:F, 7mu5:G |
2 | 6sqw:A | 114 | 108 | 0.9048 | 0.8333 | 0.8796 | 6.99e-65 | 2oig:B, 2oig:A, 2oig:D, 6sqw:D, 6sqy:A, 6sqy:D, 6sqz:A, 6sqz:D |
3 | 4qgp:A | 108 | 99 | 0.3333 | 0.3241 | 0.3535 | 6.10e-16 | 4qgp:B |
4 | 2q5z:B | 94 | 77 | 0.2571 | 0.2872 | 0.3506 | 8.79e-04 | 2q5z:A, 2q73:A, 2q73:B, 2q73:C, 2q73:D, 2q9l:A, 2q9l:B, 2q9l:C, 2q9l:D |
5 | 5ie9:C | 95 | 67 | 0.1905 | 0.2105 | 0.2985 | 0.065 | 5ie9:A, 5ie9:B, 5ie9:D |
6 | 7ody:C | 100 | 34 | 0.1429 | 0.1500 | 0.4412 | 0.68 | 7ody:A, 7ody:B, 7ody:D |
7 | 9f2k:A | 513 | 22 | 0.1048 | 0.0214 | 0.5000 | 1.3 | |
8 | 9d93:Oa | 595 | 12 | 0.0571 | 0.0101 | 0.5000 | 4.3 | 9d93:Oc, 9d93:Ob |
9 | 4dl8:A | 224 | 71 | 0.1619 | 0.0759 | 0.2394 | 4.6 | 4dk4:A, 4dk4:B, 4dkb:A, 4dlc:A |
10 | 5yip:A | 123 | 56 | 0.1333 | 0.1138 | 0.2500 | 5.6 | 7aa7:A, 7aa7:B, 7aa9:A, 7aa9:E, 7aa9:C, 7aa9:I, 7aa9:G, 7aa9:K, 7cdb:A, 7cdb:B, 6hoi:B, 6hoi:A, 6hol:A, 6hol:B, 7jhx:A, 7jhx:B, 2l8j:A, 5lxh:A, 5lxh:B, 5lxh:C, 5lxi:D, 5lxi:B, 8x8a:A, 6yoo:A |
11 | 3frh:A | 241 | 32 | 0.1143 | 0.0498 | 0.3750 | 6.5 | 3b89:A, 3fri:A |
12 | 8agd:A | 1111 | 59 | 0.1810 | 0.0171 | 0.3220 | 6.5 | 8acq:A, 8acq:C, 8acq:B, 8ae1:A, 8ae1:B, 8ae1:C, 8agd:C, 8agd:B, 7zgy:A, 7zgy:C, 7zgy:B |
13 | 5euf:B | 416 | 35 | 0.1048 | 0.0264 | 0.3143 | 6.7 | 5euf:A |
14 | 4u08:A | 391 | 55 | 0.1714 | 0.0460 | 0.3273 | 8.6 | 4u08:B |
15 | 4ry8:B | 321 | 19 | 0.0952 | 0.0312 | 0.5263 | 8.9 | 4ry8:A, 4ry8:C, 4ry8:D |
16 | 1g6u:A | 48 | 31 | 0.1143 | 0.2500 | 0.3871 | 9.7 | 1g6u:B |