FRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELSPHLHVLVQNKLRASITNPNALNLRMDTSPFSIFHP
NIQAAKDCNQVRDFITKEVSDVNTAEWGTFVAV
The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6we0:A | 119 | 118 | 1.0000 | 0.9496 | 0.9576 | 5.81e-78 | 6we1:A, 6we1:D |
2 | 7kik:A | 121 | 76 | 0.6372 | 0.5950 | 0.9474 | 1.29e-45 | |
3 | 7kik:A | 121 | 42 | 0.3628 | 0.3388 | 0.9762 | 2.28e-23 | |
4 | 7vg8:A | 108 | 114 | 0.3805 | 0.3981 | 0.3772 | 1.53e-17 | |
5 | 4bt2:A | 237 | 71 | 0.1770 | 0.0844 | 0.2817 | 0.59 | 4bt3:A, 4bt4:A, 4bt5:A, 4bt6:A, 4bt7:A |
6 | 2f2t:A | 158 | 60 | 0.1593 | 0.1139 | 0.3000 | 0.93 | 2f2t:B, 2f62:A, 2f62:B, 2f64:A, 2f64:B, 2f67:A, 2f67:B |
7 | 4uw0:A | 501 | 33 | 0.1239 | 0.0279 | 0.4242 | 6.6 | 4azw:A |
8 | 1hbr:A | 141 | 88 | 0.1947 | 0.1560 | 0.2500 | 6.7 | 1hbr:C |
9 | 4ax8:A | 450 | 33 | 0.1239 | 0.0311 | 0.4242 | 6.9 | 4azs:A, 4azt:A, 4azv:A |
10 | 2ckp:A | 316 | 72 | 0.1947 | 0.0696 | 0.3056 | 7.3 | |
11 | 4a0a:B | 355 | 64 | 0.1416 | 0.0451 | 0.2500 | 9.0 | 4a08:B, 4a09:B, 4a0b:B, 4a0b:D, 4a0k:D, 4a0l:B, 4a0l:D, 3ei1:B, 3ei2:B |