FPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPDLAKDSKGRFFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKR
EAEYFQLPDLVKLLT
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ocp:B | 99 | 96 | 1.0000 | 0.9596 | 0.9896 | 4.99e-64 | 6m8r:A, 6m8r:F, 6ocp:C, 6ocp:D, 6ocp:E, 6ocp:F, 6ocp:G, 6ocp:H, 6ocp:K, 6ocp:L, 6ocp:M, 6ocp:N |
2 | 7e8e:D | 459 | 68 | 0.2211 | 0.0458 | 0.3088 | 0.001 | 7e87:B, 7e87:A, 7e87:C, 7e87:D, 7e8e:B, 1nn7:A, 7ukg:A, 7ukg:B, 7ukg:C, 7ukg:D |
3 | 6sga:FS | 277 | 66 | 0.2632 | 0.0903 | 0.3788 | 0.002 | 6sga:FQ, 6sga:FR, 6sga:FU, 6sgb:FQ, 6sgb:FR, 6sgb:FU |
4 | 2i2r:L | 138 | 67 | 0.2105 | 0.1449 | 0.2985 | 0.002 | 2i2r:A, 2i2r:C, 2i2r:D, 2i2r:I, 2i2r:J, 2i2r:K, 2nz0:B, 2nz0:D, 1s1g:A, 1s1g:B |
5 | 2i2r:B | 124 | 67 | 0.2105 | 0.1613 | 0.2985 | 0.002 | |
6 | 8quc:A | 395 | 72 | 0.2526 | 0.0608 | 0.3333 | 0.003 | 8f1c:A, 8f1c:B, 8f1c:C, 8f1c:D, 8f1d:A, 8f1d:B, 8f1d:C, 8f1d:D, 7phi:C, 7phi:B, 7phi:D, 8quc:B, 8quc:D, 8quc:C, 8qud:A, 8qud:B, 8qud:C, 8qud:D |
7 | 7ukh:A | 203 | 68 | 0.2211 | 0.1034 | 0.3088 | 0.007 | 7ukh:B, 7ukh:C, 7ukh:D |
8 | 5b46:A | 627 | 61 | 0.2000 | 0.0303 | 0.3115 | 0.29 | 5b47:A |
9 | 1t3q:B | 786 | 35 | 0.1474 | 0.0178 | 0.4000 | 0.44 | 1t3q:E |
10 | 7c98:A | 309 | 57 | 0.2000 | 0.0615 | 0.3333 | 1.4 | 7c98:B, 7c98:C, 7c99:A, 7c99:B, 7c99:C, 7c9c:A, 7c9c:B, 7c9c:C, 7cgy:A, 7cgy:B, 7cgy:C, 8qqe:B, 8qqe:A, 8r2g:C, 8r2g:G, 8r2g:H, 8r2g:A, 8r2g:D, 8r2g:E, 8r2g:B |
11 | 5juy:B | 1234 | 73 | 0.2632 | 0.0203 | 0.3425 | 3.3 | 1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D |
12 | 1i9g:A | 264 | 52 | 0.1474 | 0.0530 | 0.2692 | 7.0 | |
13 | 8osg:F | 258 | 89 | 0.2737 | 0.1008 | 0.2921 | 7.7 | |
14 | 4ttb:A | 189 | 18 | 0.0842 | 0.0423 | 0.4444 | 7.7 | 4ttb:B |
15 | 8iuf:C1 | 495 | 30 | 0.1368 | 0.0263 | 0.4333 | 8.1 | 8iuj:c1, 8iuj:C1 |
16 | 4ttc:A | 220 | 18 | 0.0842 | 0.0364 | 0.4444 | 9.5 | 4ttc:B, 4ttc:C, 4ttc:D, 4ttc:E, 4ttc:F, 5yak:A, 5yak:F, 5yak:B, 5yak:C, 5yak:D, 5yak:E |
17 | 7mq8:NH | 1066 | 54 | 0.1789 | 0.0159 | 0.3148 | 9.9 | 7mqa:NH |