BioLiP

>protein
FKVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGSTPEFWLRLQSNYDLRQLENQI
DTSGIVLYG

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6chv:D	91	88	0.9888	0.9670	1.0000	1.67e-61	6chv:A, 6chv:C, 6chv:B, 6chv:G, 6chv:H
2	2icp:A	87	79	0.3708	0.3793	0.4177	6.44e-21
3	6fix:B	99	76	0.3146	0.2828	0.3684	3.90e-14	6fix:A, 6fix:D, 6fix:E
4	7csy:B	97	87	0.2697	0.2474	0.2759	1.47e-06	7csw:B, 7csy:A, 7csy:C, 7csy:D, 6jpi:A, 6jpi:B, 6jpi:C, 6jpi:D, 6lb3:A, 6lb3:B, 6lb3:G, 6lb3:H, 6lb3:C, 6lb3:D, 6lb3:E, 6lb3:F
5	8kdb:A	2117	71	0.3034	0.0128	0.3803	0.47	8kdc:A
6	8tac:B	66	52	0.1573	0.2121	0.2692	0.48
7	8q4s:A	295	33	0.1685	0.0508	0.4545	0.49	7qpl:A
8	6qyi:B	520	55	0.1798	0.0308	0.2909	1.8	6b1b:A, 6b1b:B, 6eb0:C, 6qyh:B, 6qyi:A
9	5lmx:B	1115	82	0.2135	0.0170	0.2317	2.9
10	5m5w:B	1183	82	0.2135	0.0161	0.2317	3.0	4c2m:B, 4c2m:Q, 4c3h:B, 4c3i:B, 4c3j:B, 5g5l:B, 6h67:B, 6h68:B, 6hko:B, 6hlq:B, 6hlr:B, 5m3f:B, 5m3m:B, 5m5x:B, 5m5y:B, 5m64:B, 5n5y:B, 5n5z:B, 5n60:B, 5n61:B, 5oa1:B, 6rqh:B, 6rql:B, 6rqt:B, 6rrd:B, 6rui:B, 6ruo:B, 6rwe:B, 6tps:B, 5w5y:B, 5w64:B, 5w65:B, 5w66:B, 4ym7:AB, 4ym7:BB, 4ym7:CB, 4ym7:DB, 4ym7:EB, 4ym7:FB
11	2or1:L	63	50	0.1573	0.2222	0.2800	3.5	2or1:R, 1per:L, 1per:R, 1rpe:L, 1rpe:R
12	4icm:A	335	60	0.1798	0.0478	0.2667	7.7	4icm:B, 4icm:C, 4icm:D, 4icm:E, 4icm:F, 4icm:G, 4icm:H, 4l6d:A, 4l6d:B, 4l6d:C, 4l6d:D, 4l6d:E, 4l6d:F, 4l6d:G, 4l6d:H, 4ng3:A, 4ng3:B, 4ng3:C, 4ng3:D, 4ng3:E, 4ng3:F, 4ng3:G, 4ng3:H, 4ni8:A, 4ni8:B, 4ni8:C, 4ni8:D, 4ni8:E, 4ni8:F, 4ni8:G, 4ni8:H
13	3h4i:A	392	46	0.2135	0.0485	0.4130	8.4	3h4t:A

[Back]