FKHTSAALERKISMRQSREELIKRGVLKEI
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4b1u:M | 30 | 30 | 1.0000 | 1.0000 | 1.0000 | 4.78e-15 | |
| 2 | 2c1l:B | 358 | 17 | 0.3000 | 0.0251 | 0.5294 | 4.7 | 3zi5:A, 3zi5:D |
| 3 | 4c9q:B | 290 | 28 | 0.3000 | 0.0310 | 0.3214 | 8.1 | 4c9g:A, 4c9h:A, 4c9h:B, 4c9j:A, 4c9j:B, 4c9q:A |
| 4 | 5t57:A | 276 | 16 | 0.2667 | 0.0290 | 0.5000 | 9.8 |
umich.edu