FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE
The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3f1i:S | 77 | 77 | 1.0000 | 1.0000 | 1.0000 | 2.31e-50 | |
2 | 4p53:A | 360 | 37 | 0.1948 | 0.0417 | 0.4054 | 0.13 | |
3 | 5e02:A | 964 | 60 | 0.2338 | 0.0187 | 0.3000 | 0.80 | |
4 | 8rmq:B | 694 | 42 | 0.1299 | 0.0144 | 0.2381 | 4.1 | 6tu5:BBB, 6tu5:EEE |
5 | 8tjc:B | 336 | 26 | 0.1429 | 0.0327 | 0.4231 | 4.4 | 7jhi:A, 7jhi:C, 7jhl:A, 7jhl:B, 7jhm:A, 7jhm:B, 7jhn:A, 7jho:A, 7jho:B, 8sz3:A, 8sz3:B, 8tic:A, 8tic:B, 8tic:C, 8tic:D, 8tjc:A, 8tjc:C, 8tjc:D, 6wmm:A, 6wmm:B, 6wmn:A, 6wmn:B, 6wmn:C, 6wmn:D, 6wmo:A, 6wmo:B |
6 | 4il2:B | 404 | 29 | 0.1688 | 0.0322 | 0.4483 | 5.7 | 4e4f:A, 4e4f:D |
7 | 4cv5:B | 260 | 38 | 0.1429 | 0.0423 | 0.2895 | 6.0 | |
8 | 2uz3:B | 207 | 37 | 0.1429 | 0.0531 | 0.2973 | 6.4 | 2b8t:A, 2b8t:B, 2b8t:C, 2b8t:D, 2uz3:A, 2uz3:C, 2uz3:D |
9 | 8jgw:A | 500 | 32 | 0.1429 | 0.0220 | 0.3438 | 7.7 |