BioLiP

>protein
FHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGT
QFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLG
MSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYAR
DMRMKIL

The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6jze:A	254	247	0.9838	0.9567	0.9838	0.0	6j4p:A, 6j4q:J, 6j4q:A, 6j4q:F, 6j4q:C, 6j4v:A, 6jzd:A, 6qby:A, 7zcw:C
2	6j7b:A	249	246	0.6235	0.6185	0.6260	1.59e-116	6j4u:A, 6j8f:B, 6j8n:B, 6j8n:D, 6j8o:B, 6j91:B, 6j9h:B, 6j9h:D, 6k81:A, 6lpg:A, 6nvq:C, 6ocg:A, 6och:A, 6och:C
3	2wyo:C	496	69	0.0850	0.0423	0.3043	0.62	2wyo:B, 2wyo:D
4	3h94:A	297	42	0.0607	0.0505	0.3571	1.2	3h94:B, 3opo:A, 3opo:B, 3ow7:A, 3ow7:B
5	2wyo:A	520	76	0.0850	0.0404	0.2763	1.7
6	2cd9:A	363	97	0.1174	0.0799	0.2990	1.7	2cd9:B, 2cda:A, 2cda:B, 2cdb:A, 2cdb:B, 2cdb:C, 2cdb:D, 2cdc:A, 2cdc:B, 2cdc:C, 2cdc:D
7	7unr:E	200	46	0.0567	0.0700	0.3043	2.7	8cd1:E, 6spb:E, 6spd:E, 6spf:E, 6spg:E, 7unu:E, 7unv:E, 7unw:E
8	7cvo:A	130	35	0.0567	0.1077	0.4000	5.8	7c9o:C, 7cvq:A, 7cvq:F, 7cvq:K, 7cvq:P
9	8tri:B	454	34	0.0486	0.0264	0.3529	6.2	7suu:A, 7suu:B, 8tri:A
10	4h6b:A	180	87	0.0972	0.1333	0.2759	6.2	4h6b:B, 4h6b:G, 4h6b:J
11	8tri:C	419	34	0.0486	0.0286	0.3529	6.6
12	6he5:D	242	108	0.1134	0.1157	0.2593	7.3	6he5:E, 6he5:A, 6he5:B, 6he5:G, 6he5:F, 6he5:C
13	1ehi:A	360	62	0.0607	0.0417	0.2419	9.6

[Back]