BioLiP

>protein
FHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGT
QFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLG
MSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYAR
DMRMKI

The query sequence (length=246) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6jze:A	254	246	0.9837	0.9528	0.9837	0.0	6j4p:A, 6j4q:J, 6j4q:A, 6j4q:F, 6j4q:C, 6j4v:A, 6jzd:A, 6qby:A, 7zcw:C
2	6j7b:A	249	246	0.6260	0.6185	0.6260	1.36e-116	6j4u:A, 6j8f:B, 6j8n:B, 6j8n:D, 6j8o:B, 6j91:B, 6j9h:B, 6j9h:D, 6k81:A, 6lpg:A, 6nvq:C, 6ocg:A, 6och:A, 6och:C
3	3h94:A	297	42	0.0610	0.0505	0.3571	1.1	3h94:B, 3opo:A, 3opo:B, 3ow7:A, 3ow7:B
4	2cd9:A	363	97	0.1179	0.0799	0.2990	1.6	2cd9:B, 2cda:A, 2cda:B, 2cdb:A, 2cdb:B, 2cdb:C, 2cdb:D, 2cdc:A, 2cdc:B, 2cdc:C, 2cdc:D
5	7unr:E	200	46	0.0569	0.0700	0.3043	2.8	8cd1:E, 6spb:E, 6spd:E, 6spf:E, 6spg:E, 7unu:E, 7unv:E, 7unw:E
6	7cvo:A	130	35	0.0569	0.1077	0.4000	5.8	7c9o:C, 7cvq:A, 7cvq:F, 7cvq:K, 7cvq:P
7	8tri:B	454	34	0.0488	0.0264	0.3529	6.2	7suu:A, 7suu:B, 8tri:A
8	4h6b:A	180	87	0.0976	0.1333	0.2759	6.4	4h6b:B, 4h6b:G, 4h6b:J
9	8tri:C	419	34	0.0488	0.0286	0.3529	6.7
10	6he5:D	242	108	0.1138	0.1157	0.2593	7.3	6he5:E, 6he5:A, 6he5:B, 6he5:G, 6he5:F, 6he5:C
11	1ehi:A	360	62	0.0610	0.0417	0.2419	9.1

[Back]