FGRNEGPMTWPWKLMCAILYMLPWVDVTEKTVYFVERFPAFVWTEYFSEPFEHWYNIHEYAPLFIFFATYLGIVRNKKIP
HVARYHVMMGVMLDIVAMILIVTEENLPTGVLWTPWSDLFYALMFWFIFLLVIYCLFFCFLGWYCEIPLISEGVYLQIEQ
AEQLGQ
The query sequence (length=166) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7xzi:B | 166 | 166 | 1.0000 | 1.0000 | 1.0000 | 1.05e-121 | |
| 2 | 6m9t:A | 444 | 55 | 0.1084 | 0.0405 | 0.3273 | 3.5 | |
| 3 | 3n75:A | 711 | 71 | 0.1205 | 0.0281 | 0.2817 | 9.1 | 3n75:D, 3n75:B, 3n75:E, 3n75:C, 6q7l:A, 6q7l:F, 6q7l:B, 6q7l:C, 6q7l:D, 6q7l:J, 6q7l:E, 6q7l:H, 6q7l:G, 6q7l:I, 6q7l:K, 6q7l:R, 6q7l:L, 6q7l:Q, 6q7l:M, 6q7l:P, 6q7l:N, 6q7l:T, 6q7l:O, 6q7l:S, 6q7m:A, 6q7m:F, 6q7m:B, 6q7m:C, 6q7m:D, 6q7m:J, 6q7m:E, 6q7m:H, 6q7m:G, 6q7m:I, 6q7m:K, 6q7m:R, 6q7m:L, 6q7m:Q, 6q7m:M, 6q7m:P, 6q7m:N, 6q7m:O, 6q7m:S, 6q7m:T |
umich.edu