BioLiP

>protein
FGIQTGDAVASTITVFQALSIDDQLAVLWYAYTEMGRSITPAATGAARLQLAEGLLNQIKQMSHAEQLQVMRDLAAKNNT
QVSRSYGILSNNTKLAFWYELSELMVKGFVVPVPTDYKISRDGSQVLEALKGLDFGQQITVLRKVVADMGVDPLA

The query sequence (length=155) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8qx5:A	158	155	1.0000	0.9810	1.0000	4.29e-113	8qx5:B
2	7ytf:A	309	152	0.5355	0.2686	0.5461	4.81e-55
3	7qd1:A	311	148	0.5161	0.2572	0.5405	3.12e-53	7qcz:A, 7qd0:A, 7qd1:C, 7qd2:A, 7qd2:C
4	6pq1:A	320	149	0.5161	0.2500	0.5369	5.11e-52
5	8pyh:B	319	150	0.4968	0.2414	0.5133	1.56e-50	8pyh:A
6	8a0h:A	324	144	0.4968	0.2377	0.5347	2.39e-50
7	5ui2:A	316	147	0.4710	0.2310	0.4966	3.56e-48	5ui2:B
8	7ekr:B	309	148	0.4903	0.2460	0.5135	9.68e-48	7ekr:A
9	5hgr:A	315	147	0.4968	0.2444	0.5238	2.84e-47	5hgr:B
10	7zsg:1	314	144	0.4645	0.2293	0.5000	1.33e-45	3mg1:A, 3mg1:B, 3mg2:A, 3mg2:B, 3mg3:A, 3mg3:B, 7sc9:BH, 7sc9:CQ, 7sc9:DI, 7sc9:EA, 7scb:BH, 7scc:AS, 7scc:BP, 6t6k:A, 6t6m:A, 6t6o:A, 8to2:B, 8tpj:B, 5tuw:A, 5tuw:B, 5tuw:C, 5tuw:D, 5tuw:E, 5tuw:F, 5tux:A, 5tv0:A, 4xb4:A, 4xb4:B, 4xb5:A, 7zsf:A, 7zsh:1, 7zsi:1, 7zsj:1, 7zxv:A
11	8pzk:A	300	147	0.4387	0.2267	0.4626	1.05e-41
12	5fcx:A	139	146	0.4129	0.4604	0.4384	6.35e-41	5fcx:B
13	6mcj:B	145	144	0.2839	0.3034	0.3056	2.72e-24	6mcj:A
14	3w1k:B	452	44	0.0903	0.0310	0.3182	2.4	3w1k:A, 3w1k:C, 3w1k:D, 3w1k:E
15	3guz:B	167	19	0.0774	0.0719	0.6316	5.5	3guz:A
16	4k9d:A	338	48	0.1032	0.0473	0.3333	8.3	4k9d:B, 4k9d:C, 4k9d:D, 4k9d:E, 4k9d:F, 4k9d:G, 4k9d:H

[Back]