FFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAA
EEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCEPEPD
VAV
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1zh1:A | 163 | 163 | 1.0000 | 1.0000 | 1.0000 | 3.64e-122 | 3fqm:A, 3fqm:B, 3fqq:A, 3fqq:B, 1zh1:B |
2 | 4cl1:D | 160 | 159 | 0.8037 | 0.8187 | 0.8239 | 4.68e-100 | 4cl1:A, 4cl1:B, 4cl1:C |
3 | 1fvp:A | 231 | 63 | 0.1043 | 0.0736 | 0.2698 | 0.90 | 1fvp:B |
4 | 5d9b:A | 307 | 76 | 0.1166 | 0.0619 | 0.2500 | 6.8 | 5d9c:A, 5d9d:A, 5gtq:A, 5gx1:A, 5gx2:A, 5gx3:A, 5gx4:A, 5gx5:A, 5xfe:A |