FFPSGTIAFFIFMMVFYAVLWFMIYWVLLERG
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7deg:C | 32 | 32 | 1.0000 | 1.0000 | 1.0000 | 1.39e-16 | 7deg:F |
| 2 | 7xzh:B | 730 | 24 | 0.2188 | 0.0096 | 0.2917 | 5.3 | 7m19:C, 7xzh:A, 7xzh:C, 7xzh:D, 7xzh:E, 7xzh:F |
| 3 | 7stm:A | 801 | 18 | 0.2188 | 0.0087 | 0.3889 | 8.8 | 7stm:B, 7stn:A, 7stn:B, 7sto:B, 7sto:A |
| 4 | 6s6b:K | 1024 | 15 | 0.2188 | 0.0068 | 0.4667 | 9.8 | 6s8b:K, 6s8e:K, 6s91:K, 6sh8:K, 6shb:K, 6sic:K |
umich.edu