FERHVFKGIEHTDTGALVSVKGSGTQEEDVPVINSGYGFTPAADTELEVFLHGDGSDASNKFATMTIPRNKQRKWPEGAG
GVQHPFNADKFVQFDDDSIWLKDGKFTLGNNQELTITVSNGLVTLSSNNEVDFRCPKLMHNGVNIGDSHVHPQKPDSGGD
SEEDTDPP
The query sequence (length=168) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fqc:A | 168 | 168 | 1.0000 | 1.0000 | 1.0000 | 3.17e-124 | |
2 | 8hsm:A | 280 | 154 | 0.2560 | 0.1536 | 0.2792 | 1.0 | 8hso:A, 8hsw:A, 8ht1:A, 8ht9:A |
3 | 3qzp:B | 125 | 27 | 0.0774 | 0.1040 | 0.4815 | 8.9 | 2itf:A, 2itf:B, 2itf:C, 2itf:D, 3qzl:A, 3qzm:A, 3qzm:B, 3qzn:A, 3qzn:B, 3qzn:C, 3qzo:A, 3qzo:C, 3qzo:B, 3qzo:D, 3qzp:A |
4 | 1e3j:A | 348 | 34 | 0.0714 | 0.0345 | 0.3529 | 9.4 |