FEMADKLYKDICCVNDSYRNIKESDSSNRNRVEQLARERELLDKLLETRDERTRAMMVTLLNEKKKKIRELHEILR
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1z56:B | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 2.26e-49 | |
2 | 6kdv:B | 283 | 51 | 0.2237 | 0.0601 | 0.3333 | 1.8 | 6kdv:D, 6kdv:C, 6kdv:A |
3 | 2dki:A | 615 | 47 | 0.1842 | 0.0228 | 0.2979 | 5.2 | 2dkh:A |
4 | 1ik9:A | 207 | 44 | 0.2105 | 0.0773 | 0.3636 | 6.2 | 1ik9:B, 3rwr:J, 3rwr:Y |
5 | 5w7c:C | 420 | 39 | 0.1711 | 0.0310 | 0.3333 | 6.3 | 5w78:B, 5w7c:D |
6 | 6m0r:A | 750 | 46 | 0.2105 | 0.0213 | 0.3478 | 8.2 | 7tao:A |
7 | 8a22:BD | 270 | 51 | 0.2237 | 0.0630 | 0.3333 | 9.7 | 8apn:BC, 8apo:BD |