FEKDLMAYFDENLNRNWRGREHWKVRNVLEIDFFKTDDSFEDKVFASKGRTKIDMPIKNRKNDTHYLLPDDFHFSTDRIT
RLFIKPAQKMSLFS
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7qfw:B | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 4.69e-66 | 7q2z:C |
2 | 2cks:B | 306 | 72 | 0.2021 | 0.0621 | 0.2639 | 0.61 | 2ckr:B, 2ckr:A, 2cks:A |
3 | 6zqg:JD | 829 | 43 | 0.1596 | 0.0181 | 0.3488 | 4.8 | |
4 | 6z1p:AS | 728 | 36 | 0.1170 | 0.0151 | 0.3056 | 8.1 |