FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSG
HELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIES
VAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGE
KIGVRYGEGFRIMPGLFYHITPFTDLI
The query sequence (length=267) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5b2e:A | 267 | 267 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5b2e:B, 5b2e:C, 5b2f:A, 5b2f:B, 5b2f:C, 3we7:A, 3we7:B, 3we7:C, 3wl3:A, 3wl3:B, 3wl3:C |
2 | 3wl4:A | 267 | 267 | 0.8801 | 0.8801 | 0.8801 | 0.0 | 3wl4:B, 4xm0:A, 4xm0:B, 4xm0:C, 4xm0:D, 4xm0:E, 4xm0:F, 4xm1:A, 4xm1:B, 4xm1:C, 4xm1:D, 4xm1:E, 4xm1:F, 4xm2:A, 4xm2:B, 4xm2:C, 4xm2:D, 4xm2:E, 4xm2:F |
3 | 8bgo:G | 271 | 267 | 0.8015 | 0.7897 | 0.8015 | 4.04e-167 | 8bgn:A, 8bgn:B, 8bgn:C, 8bgo:A, 8bgo:H, 8bgo:K, 8bgo:B, 8bgo:E, 8bgo:L, 8bgo:C, 8bgo:I, 8bgo:J, 8bgo:F, 8bgo:D, 8bgp:A, 8bgp:B, 8bgp:C, 8bgp:D, 8bgp:E, 8bgp:F |
4 | 2ixd:A | 232 | 228 | 0.2584 | 0.2974 | 0.3026 | 4.88e-22 | 2ixd:B |
5 | 6p2t:A | 232 | 228 | 0.2360 | 0.2716 | 0.2763 | 1.32e-20 | 6ull:A |
6 | 5cgz:A | 240 | 201 | 0.1685 | 0.1875 | 0.2239 | 0.003 | 5cgz:B |
7 | 1q7t:A | 310 | 153 | 0.1461 | 0.1258 | 0.2549 | 0.005 | 4ewl:A, 4ewl:B, 1q74:A, 1q74:B, 1q74:C, 1q74:D, 1q7t:B |
8 | 3dfi:A | 242 | 140 | 0.1311 | 0.1446 | 0.2500 | 0.61 | |
9 | 3ujk:A | 298 | 74 | 0.0824 | 0.0738 | 0.2973 | 1.1 | 3nmv:B, 3ujl:B |
10 | 4zda:A | 735 | 50 | 0.0637 | 0.0231 | 0.3400 | 1.2 | 4zda:B, 4zda:C, 4zda:D, 4zda:E, 4zda:F |
11 | 6iiy:A | 237 | 38 | 0.0412 | 0.0464 | 0.2895 | 4.9 | |
12 | 3dff:A | 266 | 38 | 0.0412 | 0.0414 | 0.2895 | 5.1 | 3dfk:A, 3dfm:A, 2x9l:A, 2xad:A, 2xad:B, 2xad:C, 2xad:D |
13 | 8swu:A | 269 | 67 | 0.0674 | 0.0669 | 0.2687 | 6.2 | 8swu:B, 8swu:C |
14 | 4n2i:A | 662 | 52 | 0.0674 | 0.0272 | 0.3462 | 6.5 | 4n22:A, 4n24:A, 4n26:A, 4n28:A, 4n2a:A, 4n2b:A, 4n2c:A, 4n2e:A, 4n2g:A, 4n2l:A, 4n2m:A, 4n2n:A |