FDYQTVYFANQYGLRTIELGESEFVDNTLDNQHKMVIKAAWGGGYTNRNNVVINFKVDESLCDNLYFKDTDQPLVPMPAS
YYTLASDRIAIPKGQIMAGVEVQLTDDFFADEKSISENYVIPLLMTNVQGADSILQGKPVVENPVLTNAGDWSILPQNFV
LYAVKYVNPWHGEYLRRGIDHATVAGTSKDIIRHEQFVENDEVVNISTKSMKDNLLTLKTKDESGKDISYTVRLSFAEDG
SCTVHSGSQNVVVSGSGKFVSKGEKNSLGGKDRNAIYLDYTVNLTDNNIQLATKDTLVLRTRNVYGGKSLEVVRK
The query sequence (length=315) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3n91:A | 315 | 315 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 7bgg:A | 216 | 92 | 0.0857 | 0.1250 | 0.2935 | 0.16 | 7ndm:A, 7nmk:A, 7noy:A |
3 | 4atf:C | 297 | 55 | 0.0603 | 0.0640 | 0.3455 | 0.42 | 4atf:A, 4atf:B, 4atf:D |
4 | 3h77:B | 338 | 63 | 0.0635 | 0.0592 | 0.3175 | 6.7 | 3h77:A, 3h78:A, 3h78:B |