FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gaf:i | 398 | 77 | 0.9855 | 0.1709 | 0.8831 | 5.45e-39 | 1dul:A, 1hq1:A, 3lqx:A, 2pxb:A, 2pxd:A, 2pxe:A, 2pxf:A, 2pxk:A, 2pxl:A, 2pxp:A, 2pxq:A, 2pxt:A, 2pxu:A, 2pxv:A |
2 | 2j28:9 | 430 | 102 | 0.9855 | 0.1581 | 0.6667 | 7.86e-35 | 5aka:5 |
3 | 5gad:i | 450 | 97 | 0.9130 | 0.1400 | 0.6495 | 1.72e-31 | 4c7o:A, 4c7o:C, 5gag:i, 5gah:i, 5nco:i, 7o9g:A, 7o9i:A, 2xkv:C, 2xxa:A, 2xxa:C |
4 | 7o5b:g | 403 | 63 | 0.5362 | 0.0918 | 0.5873 | 9.21e-19 | 7o9f:A, 7o9f:C, 7o9f:B, 4ue4:C |
5 | 7epk:A | 426 | 56 | 0.4203 | 0.0681 | 0.5179 | 3.03e-10 | |
6 | 4xco:C | 157 | 68 | 0.3913 | 0.1720 | 0.3971 | 3.14e-09 | |
7 | 3dm5:A | 416 | 58 | 0.3768 | 0.0625 | 0.4483 | 4.42e-09 | 3dm5:B |
8 | 3ndb:B | 420 | 67 | 0.3623 | 0.0595 | 0.3731 | 8.60e-09 | 2v3c:C, 2v3c:D, 4xco:D |
9 | 1qzw:A | 432 | 54 | 0.3913 | 0.0625 | 0.5000 | 8.05e-07 | 3kl4:A, 5l3s:A, 5l3s:C, 5l3s:E, 5l3s:G, 5l3v:A, 5l3v:B, 1qzw:C, 1qzw:E, 1qzw:G, 3zn8:M |
10 | 6z1p:AT | 166 | 54 | 0.2319 | 0.0964 | 0.2963 | 0.001 | |
11 | 3jaj:z | 426 | 34 | 0.2174 | 0.0352 | 0.4412 | 0.004 | 6frk:x, 3jan:z, 7obq:x, 6r6g:AB |
12 | 7obr:x | 488 | 34 | 0.2174 | 0.0307 | 0.4412 | 0.006 | 2go5:W, 2j37:W, 5l3q:A, 5l3q:C, 1mfq:C, 7nfx:x, 7qwq:x, 1ry1:W, 4ue5:D, 6y2z:A, 6y32:A, 6y32:C, 6y32:E, 6y32:G |
13 | 7uea:U | 364 | 32 | 0.1594 | 0.0302 | 0.3438 | 1.4 | 3bsd:A, 3eni:A, 3eni:C, 8gwa:1, 8gwa:2, 8gwa:3, 8gwa:4, 8gwa:5, 8gwa:6, 5h8z:A, 5h8z:C, 6m32:E, 6m32:F, 6m32:G, 7uea:V, 7uea:W, 7ueb:U, 7ueb:V, 7ueb:W, 7ueb:X, 7ueb:Y, 7ueb:Z, 7z6q:E, 7z6q:F, 7z6q:G, 7z6q:H, 7z6q:I, 7z6q:J |
14 | 3o0n:A | 607 | 57 | 0.2319 | 0.0264 | 0.2807 | 1.8 | 1xjm:B |
15 | 3qo8:A | 441 | 47 | 0.1884 | 0.0295 | 0.2766 | 2.0 | 3qo7:A |
16 | 8isk:B | 848 | 36 | 0.1594 | 0.0130 | 0.3056 | 2.5 | 8isk:A |
17 | 8sak:A | 1121 | 47 | 0.2319 | 0.0143 | 0.3404 | 3.3 | |
18 | 7xs0:A | 376 | 61 | 0.2319 | 0.0426 | 0.2623 | 7.6 | |
19 | 6mez:B | 359 | 42 | 0.1884 | 0.0362 | 0.3095 | 7.9 | 4bcl:A, 3eoj:A, 6mez:A, 3vdi:A |
20 | 6eko:A | 312 | 32 | 0.1594 | 0.0353 | 0.3438 | 8.4 | 6eko:B |