BioLiP

>protein
FDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNNVGVNDAFYCWECCRLGKDKDGC
PRILNLGSN

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2k0a:A	109	90	1.0000	0.8165	0.9889	1.86e-59	7dco:5, 6g90:S, 5gm6:J, 5lqw:Y, 5nrl:S, 5zwm:5
2	7dvq:6	105	88	0.5955	0.5048	0.6023	2.09e-32	7abg:y, 7abh:y, 7abi:y, 7b0i:D, 7b91:D, 7b92:D, 7b9c:D, 8ch6:D, 6en4:D, 7evn:D, 7evo:6, 6ff4:y, 8hk1:6, 8i0p:7, 8i0r:7, 8i0s:7, 8i0t:7, 8i0u:7, 8i0v:7, 5ife:D, 7omf:D, 7onb:D, 7opi:D, 7q3l:G, 7q4o:G, 7q4p:G, 7qtt:D, 6qx9:BP, 8r08:BP, 5syb:A, 5syb:B, 7vpx:6, 6y50:y, 8y7e:6, 5z56:6, 5z57:6, 5z58:6, 5zya:D
3	4nl8:A	549	31	0.1461	0.0237	0.4194	0.20
4	4nl8:E	571	31	0.1461	0.0228	0.4194	0.20	4nl8:B
5	6dgd:A	704	31	0.1461	0.0185	0.4194	0.20	6dgd:B, 4nl4:H
6	6cme:A	154	51	0.1910	0.1104	0.3333	0.33	6cme:B, 3mmk:A, 3mmk:B
7	4rul:A	823	25	0.1461	0.0158	0.5200	1.0	1cy1:A, 1cy2:A, 1cy4:A, 1cy6:A, 1cy7:A, 1cy8:A, 1mw8:X, 3px7:A
8	7wsj:A	93	60	0.1798	0.1720	0.2667	2.4	7vsq:A, 7vsq:B, 7vsq:C, 7wsj:B, 7wsj:C
9	2jtn:A	182	51	0.1573	0.0769	0.2745	3.3
10	2rgt:B	154	51	0.1573	0.0909	0.2745	4.3	2rgt:A
11	7b0n:G	694	78	0.2584	0.0331	0.2949	5.6	6gcs:A, 7o6y:A, 7o71:A, 6rfq:A, 6rfr:A, 6rfs:A, 6y79:A, 6yj4:G
12	7vsp:C	92	37	0.1124	0.1087	0.2703	6.9	7vsp:A, 7vsp:B

[Back]