FDGLAPYVETFNNRGCEFPKSGYEGPASNDDNDEMCVKVSMLRVKVSQSYAAKQIQQFSGFKESGIDVKQISNVKKIY
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7sut:A | 78 | 78 | 1.0000 | 1.0000 | 1.0000 | 4.28e-54 | 7sut:E |
2 | 4lms:A | 80 | 74 | 0.4744 | 0.4625 | 0.5000 | 1.05e-20 | |
3 | 7t7u:A | 81 | 77 | 0.4487 | 0.4321 | 0.4545 | 5.80e-20 | |
4 | 7t8s:B | 78 | 64 | 0.3462 | 0.3462 | 0.4219 | 5.96e-14 | 7t8s:F, 7t8s:J, 7t8s:N |
5 | 7tja:I | 75 | 64 | 0.3846 | 0.4000 | 0.4688 | 6.26e-13 | 7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M |
6 | 1qgw:A | 76 | 64 | 0.3974 | 0.4079 | 0.4844 | 1.27e-10 | 1xf6:A, 1xg0:A |
7 | 7t8s:D | 70 | 57 | 0.2949 | 0.3286 | 0.4035 | 5.18e-09 | 7t8s:H, 7t8s:L, 7t8s:P |
8 | 4lms:C | 68 | 55 | 0.3077 | 0.3529 | 0.4364 | 1.57e-07 | |
9 | 7sut:C | 63 | 48 | 0.2308 | 0.2857 | 0.3750 | 8.58e-06 | 7sut:G |
10 | 1qgw:B | 67 | 47 | 0.2051 | 0.2388 | 0.3404 | 4.94e-05 | 1xf6:B, 1xg0:B |
11 | 7tja:G | 67 | 47 | 0.2051 | 0.2388 | 0.3404 | 6.48e-05 | 7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O |
12 | 7t7u:C | 70 | 53 | 0.2564 | 0.2857 | 0.3774 | 6.81e-05 | |
13 | 4lm6:A | 62 | 54 | 0.2564 | 0.3226 | 0.3704 | 0.001 | 4lm6:C |
14 | 7ssf:A | 72 | 45 | 0.2564 | 0.2778 | 0.4444 | 0.005 | 7ssf:C, 7ssf:E, 7ssf:G |
15 | 4lmx:E | 66 | 58 | 0.2821 | 0.3333 | 0.3793 | 0.019 | 8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K |
16 | 4lmx:C | 66 | 65 | 0.3205 | 0.3788 | 0.3846 | 0.075 | 8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F |
17 | 3ce6:A | 486 | 32 | 0.1538 | 0.0247 | 0.3750 | 1.2 | 3ce6:B, 3ce6:C, 3ce6:D, 3dhy:A, 3dhy:B, 3dhy:C, 3dhy:D, 2ziz:A, 2ziz:B, 2ziz:C, 2ziz:D, 2zj0:A, 2zj0:B, 2zj0:C, 2zj0:D, 2zj1:A, 2zj1:B, 2zj1:C, 2zj1:D |
18 | 6rxu:UJ | 1090 | 21 | 0.1410 | 0.0101 | 0.5238 | 6.1 | 5oql:G, 6rxt:UJ, 6rxv:UJ, 6rxy:UJ, 6rxz:UJ |
19 | 7bi6:A | 829 | 52 | 0.1795 | 0.0169 | 0.2692 | 8.4 | 8a9i:A, 7bi9:A, 7z74:A, 7z75:A |