FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSE
KVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
The query sequence (length=158) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2o6d:A | 158 | 158 | 1.0000 | 1.0000 | 1.0000 | 7.16e-116 | 2o6d:B, 2o6e:A, 2o6e:B, 3pjl:A, 3pjl:B, 3pjn:A, 3pjn:B |
2 | 8t7m:B | 160 | 158 | 0.6962 | 0.6875 | 0.6962 | 1.16e-78 | 8t7l:A, 8t7l:B, 8t7m:A |
3 | 5i0x:B | 158 | 140 | 0.3734 | 0.3734 | 0.4214 | 2.23e-30 | 5i0x:A, 5i0y:A, 5i0y:B, 3nrq:A, 3nrq:B |
4 | 5i0v:A | 159 | 159 | 0.3544 | 0.3522 | 0.3522 | 2.18e-26 | 5i0v:B, 5i0w:A, 5i0w:B, 3lzl:A, 3lzl:B, 3lzn:A, 3lzn:B, 3lzo:A, 3lzo:B, 3lzp:A, 3lzp:B, 3lzq:A, 3lzq:B, 3lzr:A, 3lzr:B, 6wed:A, 6wed:B, 6wee:A, 6wee:B, 6wee:C, 6wee:D, 6wee:E, 6wee:F, 6wef:C, 6wef:D, 6wef:A, 6wef:B, 6wef:E, 6wef:F, 6wef:G, 6wef:H, 6wef:I, 6wef:J, 6wef:K, 6wef:L |
5 | 7r5e:B | 157 | 161 | 0.3987 | 0.4013 | 0.3913 | 2.51e-23 | 7r4v:B, 7r4v:A, 7r4z:A, 7r4z:B, 7r5e:A, 7r5g:A, 7r5g:B, 7r5p:A, 7r5p:B, 7r5p:C, 7r5p:D, 7r5p:E, 7r5p:F |
6 | 2aly:B | 785 | 100 | 0.1582 | 0.0318 | 0.2500 | 0.21 | 2amc:B, 1eiy:B, 3hfz:B, 2iy5:B, 1jjc:B, 3teh:B, 4tva:B |