FCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQA
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6xfk:A | 63 | 63 | 1.0000 | 1.0000 | 1.0000 | 1.54e-41 | |
2 | 1p5j:A | 319 | 44 | 0.2381 | 0.0470 | 0.3409 | 0.070 | |
3 | 1xc3:A | 295 | 59 | 0.3175 | 0.0678 | 0.3390 | 0.47 | 3lm9:A, 3ohr:A |
4 | 8fnc:5 | 297 | 39 | 0.2381 | 0.0505 | 0.3846 | 1.3 | 8fn6:5, 8fnf:5, 8fni:5, 8fnk:5 |
5 | 8jp0:A | 719 | 48 | 0.2381 | 0.0209 | 0.3125 | 1.7 | |
6 | 6m23:A | 936 | 26 | 0.1905 | 0.0128 | 0.4615 | 2.1 | 6m23:B |
7 | 6xyw:AF | 84 | 25 | 0.1746 | 0.1310 | 0.4400 | 2.3 | |
8 | 8cip:A | 665 | 31 | 0.1587 | 0.0150 | 0.3226 | 2.7 | 8cip:B, 8cip:C, 8cip:D |
9 | 7tei:B | 1042 | 44 | 0.2222 | 0.0134 | 0.3182 | 3.1 | |
10 | 5z99:A | 485 | 48 | 0.2222 | 0.0289 | 0.2917 | 7.6 | 5yyb:A, 5yyb:B |
11 | 7xzi:A | 1598 | 39 | 0.2063 | 0.0081 | 0.3333 | 9.6 | |
12 | 7vcf:A | 1496 | 39 | 0.2063 | 0.0087 | 0.3333 | 9.8 | |
13 | 2pv7:B | 280 | 38 | 0.2063 | 0.0464 | 0.3421 | 9.9 | 2pv7:A |