FAGTVSALASIGLGLLGKSSATPSVIKGIAQQAVGAVQANPGILEGAVKAIGSVGARLVGSIKARRA
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2qqp:F | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 8.73e-39 | |
2 | 7xe1:A | 751 | 28 | 0.1940 | 0.0173 | 0.4643 | 0.16 | 4fwe:A, 4fwf:A, 4fwj:A, 4fwj:B, 4gu0:A, 4gu0:C, 4gu0:B, 4gu0:D, 4gu1:A, 4gu1:B, 4gur:A, 4gus:A, 4gut:A, 4guu:A, 4hsu:A, 6r1u:K, 6r25:K, 7xe1:B, 7xe2:A, 7xe2:B, 7xe3:A, 7xe3:B |
3 | 2uvn:A | 399 | 31 | 0.1940 | 0.0326 | 0.4194 | 4.2 | 2uuq:A, 2uvn:B, 2wgy:A, 2wh8:A, 2wh8:B, 2wh8:C, 2wh8:D, 2whf:A |
4 | 8fmw:K | 117 | 56 | 0.2687 | 0.1538 | 0.3214 | 6.3 |