FAFNVLKYITFRSFTAVLIAFFLTLVLSPSFINRLRKIVKKYTPTMGGIVILIVVTLSTLLLMRWDIKYTWVVLLSFLSF
GTIGFWDDYVKLKNKKGISIKTKFLLQVLSASLISVLIYYWADIDTILYFPFFKELYVDLGVLYLPFAVFVIVGSANAVN
LTDGLDGLAIGPAMTTATALGVVAYAVGHSKIAQYLNIPYVPYAGELTVFCFALVGAGLGFLWFNSFPAQMFMGDVGSLS
IGASLATVALLTKSEFIFAVAAGVFVFETISVILQIIYFRWTGGKRLFKRAPFHHHLELNGLPEPKIVVRMWIISILLAI
IAISMLKL
The query sequence (length=328) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 9b70:B | 341 | 341 | 0.9878 | 0.9501 | 0.9501 | 0.0 | 9b70:A, 9b71:A, 9b71:B, 5ckr:A, 8cxr:A, 6oyh:A, 6oyh:C, 6oyh:B, 6oyh:D, 6oyz:A, 6oz6:A |
2 | 6oz6:C | 322 | 328 | 0.9695 | 0.9876 | 0.9695 | 0.0 | 8cxr:C, 6oz6:B |
3 | 5jnq:A | 307 | 305 | 0.3201 | 0.3420 | 0.3443 | 9.99e-41 | |
4 | 5o5e:A | 381 | 176 | 0.1311 | 0.1129 | 0.2443 | 1.11e-05 | 6bw5:A, 6bw5:B, 6bw5:C, 6bw6:A, 6bw6:B, 6bw6:C, 6bw6:D, 6fm9:A, 6fwz:A |
5 | 6bw5:D | 362 | 175 | 0.1250 | 0.1133 | 0.2343 | 5.87e-04 | |
6 | 6o0e:A | 799 | 32 | 0.0396 | 0.0163 | 0.4062 | 2.7 | |
7 | 3d8v:A | 478 | 112 | 0.0823 | 0.0565 | 0.2411 | 5.7 | 3dj4:A, 4g3p:A, 4g3q:A, 4g3s:A, 4g87:A, 6ge9:A, 4hcq:A, 4k6r:A, 2qkx:A, 3spt:A, 3st8:A |