FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLW
The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8t56:E | 36 | 36 | 1.0000 | 1.0000 | 1.0000 | 2.40e-18 | 8t56:I, 8t56:D, 8t56:H |
2 | 1ynp:B | 298 | 20 | 0.2778 | 0.0336 | 0.5000 | 0.26 | 1ynp:A, 1ynq:A, 1ynq:B |
3 | 7cim:A | 524 | 20 | 0.2500 | 0.0172 | 0.4500 | 1.4 | 7cig:A, 7cig:B, 7cii:A, 7cii:B, 7cij:A, 7cij:B, 7cim:B |
4 | 5ds9:B | 98 | 17 | 0.2222 | 0.0816 | 0.4706 | 4.1 | 5ds9:A, 5dtd:A, 5dtd:B, 5e3l:A, 5e3l:B, 5e3m:A, 5e3m:B, 5e3n:A, 5e3n:B, 5e3o:A, 5e3o:B, 1fip:A, 1fip:B, 4ihv:A, 4ihv:B, 4ihw:A, 4ihw:B, 4ihx:A, 4ihx:B, 4ihy:A, 4ihy:B, 3iv5:A, 3iv5:B, 3jr9:A, 3jr9:B, 3jra:A, 3jra:B, 3jrb:A, 3jrb:B, 3jrc:A, 3jrc:B, 3jrd:A, 3jrd:B, 3jre:A, 3jre:B, 3jrf:A, 3jrf:B, 3jrg:A, 3jrg:B, 3jrh:A, 3jrh:B, 3jri:A, 3jri:B, 6p0s:A, 6p0s:B, 6p0t:B, 6p0t:A, 6p0u:A, 6p0u:B |
5 | 3b50:A | 310 | 25 | 0.2778 | 0.0323 | 0.4000 | 9.2 | 2cex:A, 2cex:B, 2cex:C, 2cex:D, 2cey:A, 8cp7:A, 6h75:A, 6h76:A, 2v4c:A, 2wx9:A, 2wyk:A, 2wyp:A, 2xa5:A, 2xwi:A, 2xwk:A, 2xwo:A, 2xwv:A, 2xxk:A |