FACVECRQQKSKCDAHPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNL
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2er8:A | 68 | 65 | 1.0000 | 0.8824 | 0.9231 | 3.65e-36 | 2er8:B, 2er8:C, 2er8:D, 2ere:A, 2ere:B, 2erg:A, 2erg:B |
2 | 1pyi:A | 88 | 59 | 0.3500 | 0.2386 | 0.3559 | 0.055 | 1pyi:B |
3 | 1ajy:A | 71 | 29 | 0.2000 | 0.1690 | 0.4138 | 0.67 | 1ajy:B, 1zme:C, 1zme:D |
4 | 6o19:A | 59 | 29 | 0.2167 | 0.2203 | 0.4483 | 0.77 | 6e33:A |
5 | 8q3b:A | 1423 | 17 | 0.1000 | 0.0042 | 0.3529 | 2.1 | 8q3k:A |
6 | 6kmj:A | 112 | 35 | 0.2167 | 0.1161 | 0.3714 | 2.7 | 7f3s:A |
7 | 2vn0:A | 464 | 56 | 0.3333 | 0.0431 | 0.3571 | 2.8 | 2nnh:A, 2nnh:B, 2nni:A, 2nnj:A, 1pq2:A, 1pq2:B |
8 | 6gys:B | 579 | 21 | 0.1667 | 0.0173 | 0.4762 | 4.4 | 6f07:B, 6gyp:B, 6gys:C, 6gys:J, 6gys:I, 6gyu:B, 7k7g:M, 8ow1:CE |
9 | 1cld:A | 33 | 30 | 0.2167 | 0.3939 | 0.4333 | 6.4 | |
10 | 2rqb:A | 135 | 36 | 0.1833 | 0.0815 | 0.3056 | 7.9 | 3ga3:A |