BioLiP

>protein
EYPIGTPQNLAGMEIAAVYLQPIDMEPEGHMRKASESDIHIEADIHALSNNPNGYPEGFWVPFLFIKYEITKVGGSGAPI
TGDMMAMVASDGPHYGDNVKLQGPGKYKVKYTIYPPNAKENPMSPYYGRHTDRETGVRPWFKTFSVEWDFTYAG

The query sequence (length=154) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7r5e:B	157	154	1.0000	0.9809	1.0000	2.92e-114	7r4v:B, 7r4v:A, 7r4z:A, 7r4z:B, 7r5e:A, 7r5g:A, 7r5g:B, 7r5p:A, 7r5p:B, 7r5p:C, 7r5p:D, 7r5p:E, 7r5p:F
2	5i0v:A	159	161	0.5519	0.5346	0.5280	3.48e-51	5i0v:B, 5i0w:A, 5i0w:B, 3lzl:A, 3lzl:B, 3lzn:A, 3lzn:B, 3lzo:A, 3lzo:B, 3lzp:A, 3lzp:B, 3lzq:A, 3lzq:B, 3lzr:A, 3lzr:B, 6wed:A, 6wed:B, 6wee:A, 6wee:B, 6wee:C, 6wee:D, 6wee:E, 6wee:F, 6wef:C, 6wef:D, 6wef:A, 6wef:B, 6wef:E, 6wef:F, 6wef:G, 6wef:H, 6wef:I, 6wef:J, 6wef:K, 6wef:L
3	5i0x:B	158	154	0.4935	0.4810	0.4935	1.51e-45	5i0x:A, 5i0y:A, 5i0y:B, 3nrq:A, 3nrq:B
4	8t7m:B	160	159	0.4545	0.4375	0.4403	1.23e-31	8t7l:A, 8t7l:B, 8t7m:A
5	2o6d:A	158	161	0.4091	0.3987	0.3913	2.37e-23	2o6d:B, 2o6e:A, 2o6e:B, 3pjl:A, 3pjl:B, 3pjn:A, 3pjn:B
6	4a69:A	369	64	0.1299	0.0542	0.3125	0.66	4a69:B
7	6j38:A	368	37	0.0909	0.0380	0.3784	4.1	6j38:B, 6j39:A, 6j39:B
8	7fgx:D	563	34	0.1039	0.0284	0.4706	6.1	7fgw:A, 7fgw:B, 7fgw:C, 7fgw:D, 7fgx:A, 7fgx:B, 7fgx:C, 7fgy:A, 7fgy:B, 7fgy:C, 7fgy:D
9	3dwb:A	660	20	0.0649	0.0152	0.5000	8.2
10	6mea:A	162	43	0.0844	0.0802	0.3023	8.6	6mea:B, 6meb:A, 6meb:B, 6men:A, 6men:B

[Back]