EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEP
GVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKK
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3dwp:C | 120 | 116 | 1.0000 | 0.9667 | 1.0000 | 2.54e-85 | 3dwp:A, 3dwp:B, 3dwp:D, 3dwp:E, 3dwq:A, 3dwq:C, 3dwq:D, 3dwq:E |
2 | 6p4q:B | 115 | 114 | 0.4914 | 0.4957 | 0.5000 | 1.47e-38 | 7k7h:E, 6p4m:A, 6p4m:B, 6p4m:C, 6p4m:D, 6p4m:E, 6p4n:C, 6p4n:D, 6p4n:E, 6p4q:A, 6p4q:C, 6p4q:D, 6p4q:E, 6p4r:A, 6p4r:B, 6p4r:C, 6p4r:D, 6p4r:E, 6p4t:A, 6p4t:C, 6p4t:D, 4rhs:C, 4rhs:E, 6tyn:A, 6tyn:C, 6tyn:D, 6tyn:E, 6tyo:A, 6tyo:C, 6tyo:D, 6tyo:E, 6tyq:C, 6tyq:D, 6tyq:E, 5wht:A, 5wht:C, 5wht:B, 5wht:D |
3 | 7ee5:E | 120 | 87 | 0.3017 | 0.2917 | 0.4023 | 3.79e-16 | 7ee4:A, 7ee4:D, 7ee4:E, 7ee5:A, 7ee5:D |
4 | 5whu:H | 124 | 88 | 0.2672 | 0.2500 | 0.3523 | 4.59e-13 | 5whu:A, 5whu:C, 5whu:D, 5whu:E, 5whu:I, 5whu:J, 5whv:F |
5 | 1jmx:A | 493 | 18 | 0.0862 | 0.0203 | 0.5556 | 1.7 | 1jmz:A |
6 | 5ngy:A | 1265 | 18 | 0.0776 | 0.0071 | 0.5000 | 9.1 | 6htv:A, 5lfc:A, 5lfc:B, 5ngy:B, 5o8l:A |
7 | 2z2p:A | 293 | 83 | 0.1638 | 0.0648 | 0.2289 | 9.4 | 2z2p:B |