EWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYKY
EPHYDYFHDPPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPA
SLHGSCPTLKGDKWSATKWIHVAPIG
The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jig:B | 195 | 193 | 0.9946 | 0.9487 | 0.9585 | 9.74e-134 | 3gze:B, 3gze:D |
2 | 2jig:A | 216 | 214 | 1.0000 | 0.8611 | 0.8692 | 1.39e-131 | 3gze:A, 3gze:C |
3 | 5v7y:A | 207 | 187 | 0.3441 | 0.3092 | 0.3422 | 1.70e-30 | 5hv0:A, 5hv0:B, 5hv4:A, 5iav:A, 5iav:B, 5iax:A, 5iax:B, 5v7y:B, 5v7y:D, 5v7y:C |
4 | 6tp5:A | 370 | 185 | 0.3118 | 0.1568 | 0.3135 | 1.37e-16 | 6tp5:B |
5 | 6tp5:A | 370 | 66 | 0.1075 | 0.0541 | 0.3030 | 0.57 | 6tp5:B |
6 | 5c5u:B | 190 | 182 | 0.2957 | 0.2895 | 0.3022 | 1.03e-13 | 5c5t:A, 5c5t:B, 5c5u:A |
7 | 3oa8:A | 229 | 51 | 0.0699 | 0.0568 | 0.2549 | 3.0 | 3oa8:C, 3oa8:E, 3ocd:A, 3ocd:C |
8 | 6ldk:A | 813 | 51 | 0.0753 | 0.0172 | 0.2745 | 4.0 | |
9 | 7ju3:B | 203 | 51 | 0.0860 | 0.0788 | 0.3137 | 4.4 | 8fw0:A, 8fw0:B, 8fw0:C, 8fw0:D, 8fw3:C, 8fw3:D, 8fw3:A, 8fw3:B, 8fw8:B, 8fw8:C, 8fw8:D, 7jnp:A, 7jnp:B, 7ju3:A, 8ssh:C, 8ssh:D, 8ssh:A, 8ssh:B |
10 | 3ggl:A | 161 | 54 | 0.1022 | 0.1180 | 0.3519 | 5.9 | 6oe2:A |
11 | 4qbb:A | 159 | 46 | 0.0860 | 0.1006 | 0.3478 | 7.6 | 4qbb:B, 4qbb:C |
12 | 8ajk:B | 447 | 32 | 0.0591 | 0.0246 | 0.3438 | 8.3 | 8ajj:C, 8ajj:A, 8ajj:B, 8ajj:D, 8ajk:A |
13 | 7dqx:D | 770 | 131 | 0.1667 | 0.0403 | 0.2366 | 9.0 | 7dqx:A |