EWAKHLLDTKYIEKYNIQNSNTLPMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNGLQWFSD
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ktx:D | 74 | 74 | 1.0000 | 1.0000 | 1.0000 | 5.69e-52 | 7kra:D |
2 | 7miz:x | 143 | 26 | 0.1351 | 0.0699 | 0.3846 | 0.92 | 7miz:k, 7tnq:w, 7tnq:x |
3 | 3wst:I | 644 | 39 | 0.1757 | 0.0202 | 0.3333 | 1.5 | 3wst:A, 3wst:D, 3wst:B, 3wst:C, 3wst:F, 3wst:E, 3wst:G, 3wst:H, 3wst:M, 3wst:N, 3wst:O, 3wst:P, 3wst:Q, 3wst:R, 3wst:J, 3wst:K, 3wst:L, 3x0d:A |
4 | 5o1n:A | 442 | 45 | 0.2568 | 0.0430 | 0.4222 | 3.2 | 5l78:A, 5l78:B, 5o1o:A, 5o1o:B |
5 | 6h18:A | 523 | 47 | 0.1757 | 0.0249 | 0.2766 | 3.6 | 6h0t:A, 6h0v:A, 6h19:A, 6h1a:A |
6 | 5txe:A | 652 | 33 | 0.1622 | 0.0184 | 0.3636 | 5.7 | 5txe:B |
7 | 1aql:A | 532 | 47 | 0.1622 | 0.0226 | 0.2553 | 7.6 | 1aql:B |
8 | 8snb:6R | 72 | 47 | 0.1757 | 0.1806 | 0.2766 | 8.6 |